KEGG   Collimonas arenae: LT85_2561Help
Entry
LT85_2561         CDS       T03512                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
care  Collimonas arenae
Pathway
care00071  Fatty acid degradation
care00072  Synthesis and degradation of ketone bodies
care00280  Valine, leucine and isoleucine degradation
care00310  Lysine degradation
care00362  Benzoate degradation
care00380  Tryptophan metabolism
care00620  Pyruvate metabolism
care00630  Glyoxylate and dicarboxylate metabolism
care00640  Propanoate metabolism
care00650  Butanoate metabolism
care00900  Terpenoid backbone biosynthesis
care01100  Metabolic pathways
care01110  Biosynthesis of secondary metabolites
care01120  Microbial metabolism in diverse environments
care01130  Biosynthesis of antibiotics
care01200  Carbon metabolism
care01212  Fatty acid metabolism
care02020  Two-component system
Brite
KEGG Orthology (KO) [BR:care00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LT85_2561
   00630 Glyoxylate and dicarboxylate metabolism
    LT85_2561
   00640 Propanoate metabolism
    LT85_2561
   00650 Butanoate metabolism
    LT85_2561
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LT85_2561
   00072 Synthesis and degradation of ketone bodies
    LT85_2561
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LT85_2561
   00310 Lysine degradation
    LT85_2561
   00380 Tryptophan metabolism
    LT85_2561
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LT85_2561
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LT85_2561
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LT85_2561
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:care04147]
    LT85_2561
Enzymes [BR:care01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LT85_2561
Exosome [BR:care04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LT85_2561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIY41719
UniProt: A0A0A1FDH6
Position
complement(2884530..2885714)
Genome map
AA seq 394 aa AA seqDB search
MQREVVVVSGVRTAIGDFGGSLKDFSPTELGAAVVLEALVRAQVSGDEVGNVVFGNVIQT
EPKDMYLARVAALNGGVAEHAPALTLNRLCGSGLQAIISAAQGILLGDADIAIGGGAESM
SRAPFISSDMRFGARMGDSRLIDMMLGALHDPFHGIHMGVTAENVAQKYGISREEQDALA
LESHRRAAHAIEQGYFRDQILPIKLKSKKGDILFDKDEHVRSHSSLDDFTKLRPIFTKEN
GTVTAGNASGINDAAAAVVLMERSVAEQRGLKPLARLVSYAHAGVDPKYMGIGPVPATRK
ALERAGLTVADLDVIEANEAFAAQACAVTKELSLDAGKVNPNGSGISLGHPIGATGALIT
VKALYELRRVGGRYALVTMCIGGGQGIAAIFERM
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgagaagtcgtggtagttagcggtgtacgtaccgccatcggggatttcggcggc
agcctgaaagatttttcaccaaccgagcttggtgctgccgtcgtgctcgaggcgctggtc
cgcgcgcaagtctcgggagacgaagtgggtaacgtcgtgttcggcaatgtaatccagacc
gaacccaaggatatgtatctggcgcgcgtggcagcgcttaacggcggcgtcgccgaacat
gcgccggcgctcacgctcaaccgcctgtgcggctccggcctgcaggccattatctctgcc
gcacaaggcattttgctgggcgatgccgatatcgccattggcggcggtgcggaatccatg
agcagggcgccgttcatatcgtccgacatgcgtttcggtgcgcgcatgggcgactcgcgc
ttgatcgacatgatgctgggcgctttgcacgacccattccacgggattcacatgggcgtc
accgcagagaatgtcgcgcagaaatatggtatttcgcgcgaagagcaggacgccctggcg
ctcgaatcccatcggcgcgcagcgcatgcgatcgaacaaggctacttccgcgaccagatt
ctgccgatcaagctgaaatcgaaaaaaggagacatcctgttcgacaaggacgagcatgta
cgcagtcactcgagcctggacgatttcaccaagctccgtccgatcttcaccaaggaaaac
ggtactgtcactgcgggcaacgcgtcgggcattaacgatgccgccgctgcggtcgtcctg
atggaacgcagcgtcgctgaacagcgcggcctgaaaccgctggcgcgcctggtctcctat
gcccatgcgggcgtcgatccgaaatacatgggcatcggtccagtgccggcgacacgtaag
gcgctcgaacgcgccggactcacggtcgccgatctcgatgtgatcgaagccaacgaggcg
ttcgctgctcaggcatgtgctgtcacaaaagagttgagtcttgatgccggcaaggtaaat
ccaaacggctcgggcatctcgcttggccacccgatcggcgccaccggtgcgctgatcacg
gtgaaggcgctgtacgaactgaggcgcgttggcggtcgttacgcactggtgaccatgtgc
ataggtggcggccagggcattgccgccatattcgagcggatgtaa

DBGET integrated database retrieval system