KEGG   Collimonas arenae: LT85_3340Help
Entry
LT85_3340         CDS       T03512                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
care  Collimonas arenae
Pathway
care00670  One carbon pool by folate
care00790  Folate biosynthesis
care01100  Metabolic pathways
Module
care_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:care00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LT85_3340
   00670 One carbon pool by folate
    LT85_3340
Enzymes [BR:care01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LT85_3340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 IMS
Motif
Other DBs
NCBI-ProteinID: AIY42498
UniProt: A0A0A1FCL6
Position
3761893..3762405
Genome map
AA seq 170 aa AA seqDB search
MTTRLTIIVATDARNGIGIRNTLPWRLPEDLAHFKRTTSGHPIIMGRKTFESIGRPLPQR
RNIVITRNPDWRHEGVESASSLAAAAALVGDAEAFIIGGAEIYAAAQDLTERQIVTEIQH
NFDCDAFYPARDPLQWQEISRESHHSEANGFDYAFVVYQRRPAGSGEANS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacgcctcacgattattgtcgccaccgatgcccgcaacggcataggtatccgt
aatactttgccctggcgcttgccagaggatctggcgcactttaaacgcaccacctcggga
cacccgatcatcatgggccgcaaaacctttgaatcgattggccgccccctgccgcagaga
cgcaacatcgtcatcacccgcaatcccgattggcgtcacgaaggcgtcgaaagcgcatcg
tcgctagctgccgcagcggcgctggtcggcgatgccgaggcattcattatcggcggcgcc
gaaatctatgccgccgcccaggacttgaccgagcggcagatcgttaccgagatccagcac
aatttcgactgcgacgccttttatccggcgcgcgatccgctgcaatggcaggaaatttcc
cgcgaaagccatcactccgaagctaacggtttcgactacgctttcgtggtctaccagcgg
cggccagccggcagcggcgaggccaacagctaa

DBGET integrated database retrieval system