KEGG   Collimonas arenae: LT85_4580Help
Entry
LT85_4580         CDS       T03512                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
care  Collimonas arenae
Pathway
care00670  One carbon pool by folate
care01100  Metabolic pathways
care01120  Microbial metabolism in diverse environments
care01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:care00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LT85_4580
Enzymes [BR:care01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     LT85_4580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AIY43738
UniProt: A0A0A1FG97
Position
complement(5135345..5136199)
Genome map
AA seq 284 aa AA seqDB search
MAQKMTQKNFSIEFFPPKTPEGTEKLRVTRAKLAELHPRYFSVTFGAGGSTQKGTLDTVL
DIRSEGHEAAPHLSCLGSSRESLRAILTQYKDHGIKRLVALRGDLPSGYGAMDFSSGEFR
YANELVEFIRAETGDWFHIEVAAYPEMHPQAKSPQDDVQRYVSKVKAGANGAITQYFYNA
DAYFRFVDEAQKLGATVPVVAGIMPITNYSQLMRFSDMCGTEIPRWIRLKLASYGDDTDS
IRAFGLDVVTQLCERLLAGGAPGLHFYTLNQSPATIAIWQRLKL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttggcacagaaaatgacacaaaagaattttagtattgaatttttcccgccgaagacaccc
gagggcaccgaaaagctgcgggtgacgcgcgccaaactggcagaactgcatccgcgctat
ttctcggtcactttcggcgcaggcggttcgacccagaagggcacgctggataccgtgctg
gatatccgcagcgaaggccacgaagcggcgccgcacctatcctgtctgggcagttcgcgc
gaatcattgcgcgccatcctgacgcaatataaggatcacggtatcaagcgcttggtggct
ttgcgcggcgatttaccgagtggctacggcgcgatggatttttcttccggtgagttccgc
tacgcgaatgaactggtggaattcattcgtgcggaaaccggtgactggtttcatatcgaa
gtcgcggcttatcctgagatgcatccacaggcaaagtcgccgcaagacgacgtgcagcgt
tatgtgagcaaggtaaaggccggcgccaacggcgctatcacacagtatttctacaatgcg
gacgcgtatttccgttttgtcgacgaagcgcaaaaattgggcgcgacggtgccggtggtt
gccggcatcatgccgatcaccaactactcgcaactgatgcgtttttccgacatgtgcggc
actgagatcccgcgctggattcgcctgaagttggccagttatggcgacgacaccgattcg
atccgggcttttggcctggatgtggtgacgcaactttgcgagcgcttgctggccggcggc
gcaccgggcttgcatttctatacgctgaatcaatcgcctgcgacgattgccatctggcag
cgcctgaagttataa

DBGET integrated database retrieval system