KEGG   Clostridium argentinense: RSJ17_06300
Entry
RSJ17_06300       CDS       T05123                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
carg  Clostridium argentinense
Pathway
carg00230  Purine metabolism
carg01100  Metabolic pathways
carg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:carg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RSJ17_06300
Enzymes [BR:carg01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     RSJ17_06300
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ARC86966
Position
1247994..1250267
AA seq 757 aa
MIGQNIPRVDAYEKVTGRVKFTDDLILNQCLVAKVYHSTIANGIVKSIDTSEAEALDGVV
KVVTFKDVPKQTYPTPGHPWSVEPAHQDVADRNILTGRVRYYGDDIAAVIAEDEVIAARA
LKLIKIEYEEYKPEIHPRESMKGSNPPIHEEKPDNILAKSEYEIGNVKEAFESAEVVVDG
NYKTQVVQHCHIENPISYAYMEKGRIVIVSSTQIPHIVKRVIGQALGISWGKVRVIKPYI
GGGFGNKQDVLYEPLNAFLTTQVGGRPVKLDVTREETFVCTRTRHSIEYDLKAGVDKEGI
IIGKEMHAYSNQGAYASHGHAIVANGATAWRHLYHVDNIKATAYTVYTNTPVGGAMRGYG
IPQMCFASEAFIDDIAYKINMDPLEFRKKNLIKGYFKDPYLTPIAANTNGVMECMDKGAK
YIDWQKKREQYRNQTGNIRRGVGMSVFSYKTGVWPISLEIAGARLVMNQDGSVQLMVGAT
EIGQGSDTVFSQMVAETLHINMEDVHIQSVQDTDVTPFDTGAYASRQSYVTGTAVKQCAE
QMYEKILTYAKTLLKEEYNQLEIEDGWILGDGKKVLSLEELAMESYYSLSNSSVITSEVS
LQTKKNAIATGCCFAEVEVDIKLGKVKIIKIINIHDSGVLLNPQLAVMQIHGGMSMGIGY
GLSEQLLVDEKTGRVLNGTLLDYKMPTTMDLPDLDVDFVELEEPTGPYGNKALGEPPAIP
PAPAIRNAVLHATGVSLHEIPMSPQRLIDAFTKAGLI
NT seq 2274 nt   +upstreamnt  +downstreamnt
gtgattggacaaaacattccgagagtagatgcttacgaaaaagttactggcagagtaaaa
tttacggatgatttgattttaaatcaatgtcttgtggcaaaagtgtatcattctaccatt
gccaatggaattgtaaagtcaattgataccagtgaagcagaagctttagacggggttgta
aaggttgtaacatttaaagatgtaccaaaacaaacttatcctactccaggtcatccctgg
tcagtggaacctgctcatcaagatgtggcagaccgtaatattttgacaggaagagtccgc
tattatggagatgatattgcggctgttattgcagaggatgaagtaatcgcggctagggct
ttaaaattaattaaaattgagtacgaagaatataagcctgagatacatccaagagaatct
atgaaagggagcaatcctccgattcatgaagaaaagcctgataatattcttgccaaaagc
gaatatgaaatcggcaatgtgaaagaagcttttgaatcggcggaagtggttgtagacgga
aattataaaactcaggttgtgcagcattgccatattgagaatcctatctcatatgcgtat
atggagaaaggacgtattgtgattgtcagctctacacagattccccatattgtaaaaagg
gttataggacaagcattaggaatttcatggggaaaagtaagagttataaagccttatatc
ggcggaggattcggaaataaacaggatgtgttatatgagcctttgaatgcttttttaaca
acacaggtaggcggccgccctgtaaaattagatgttacaagagaggaaacctttgtttgc
actagaacaagacactccatagaatatgatcttaaagcaggagtagacaaagaaggaata
atcattggtaaagaaatgcacgcttattccaatcaaggagcatatgcttctcatggtcat
gcgattgttgccaacggtgcaactgcatggagacatttgtatcatgtagacaatattaaa
gcaacggcttatacggtctataccaatactcctgtaggtggagccatgagaggatatggt
attccacagatgtgctttgcaagtgaagcttttatagatgatattgcttataaaattaat
atggatccattagagttccgtaagaagaatttaattaagggatactttaaagatccttat
cttactcctatagcagccaatacaaatggtgttatggaatgtatggataagggagctaag
tatattgattggcagaaaaaacgagaacaataccgaaatcagacagggaatatccgcagg
ggagtcggtatgtcggtgtttagttataaaactggtgtatggcctatttctcttgaaata
gcaggtgccagactggttatgaatcaagacggcagtgtacaacttatggttggagctact
gagataggacagggttcagatacggtattttcacaaatggtagcggaaactttgcatata
aatatggaagatgttcatattcagtctgttcaggatacggatgttacaccatttgataca
ggtgcttatgcatccagacagtcttatgtaacaggtactgcagtaaaacagtgtgcagaa
cagatgtatgaaaagattttaacttatgctaaaacacttctgaaagaagaatataaccaa
ttagagattgaagacggatggatattaggagatgggaaaaaagtattgtccttagaagag
ttagctatggaaagttactacagcctcagcaattcctctgttattacatcggaagtatct
cttcagacgaaaaagaatgccatagcaactggatgctgttttgcagaagtagaagtagat
attaagcttggaaaagtaaaaattataaaaataatcaatatccatgacagtggagtatta
ctgaatcctcagcttgctgttatgcagatacatggaggaatgtccatgggaattggttat
ggattaagcgagcaattgcttgtggatgagaaaacaggcagagtcttaaacggtacattg
ttagattacaaaatgccaacaacaatggacttaccggacctggatgttgattttgtagaa
ttagaagaacctacaggaccttatggcaataaagcattgggagaaccaccagccattccg
ccagctccagctattcgtaatgctgtcttacatgcaactggtgtcagccttcatgagatt
cctatgtctcctcaaagattaatcgatgcttttaccaaagcaggtttaatatag

DBGET integrated database retrieval system