KEGG   Clostridium argentinense: RSJ17_06310
Entry
RSJ17_06310       CDS       T05123                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
carg  Clostridium argentinense
Pathway
carg00230  Purine metabolism
carg01100  Metabolic pathways
carg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:carg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RSJ17_06310
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 SWIRM DUF5101
Other DBs
NCBI-ProteinID: ARC84175
Position
1251163..1251654
AA seq 163 aa
MNKEMRLVKCIVNGKEVAEYIDVRESLLDMLRNRLGLTSVKKGCEVGECGACTVIIDGET
VDSCIYLAVWAEGKNIRTLEGLLGENGELTRIQEAFIEEGAVQCGFCTPGFVMSATVLLE
RGEKLSREAIKKHMAGNLCRCTGYHNIVSAVEKVMEENGVDQS
NT seq 492 nt   +upstreamnt  +downstreamnt
atgaataaagagatgcggctggtaaaatgcatagtaaatggaaaagaagtagctgaatat
atagacgtgagggaatccttattggatatgctacgtaaccgtttaggacttacttcagta
aaaaaaggctgtgaagtaggtgaatgcggtgcttgtaccgtaattattgatggcgaaaca
gttgattcttgtatctacttggcagtatgggcagaaggtaagaatatcagaacattggaa
ggactccttggagaaaatggggaattaaccagaattcaagaggcatttattgaagaagga
gcagttcagtgcggattctgcacaccaggatttgtaatgtcagctactgttttattagaa
cgaggagaaaagctttccagagaagctattaaaaagcatatggcgggaaacttatgccgc
tgtactggatatcacaatattgtatcggcagtagaaaaagtaatggaagaaaatggagtt
gatcagagttag

DBGET integrated database retrieval system