KEGG   Clostridium argentinense: RSJ17_08690
Entry
RSJ17_08690       CDS       T05123                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
carg  Clostridium argentinense
Pathway
carg00472  D-Arginine and D-ornithine metabolism
carg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:carg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    RSJ17_08690
Enzymes [BR:carg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     RSJ17_08690
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A efThoc1 DUF1192
Other DBs
NCBI-ProteinID: ARC84602
Position
1763937..1764299
AA seq 120 aa
MKREDDFQSRRQHLKNLSDEELYERFWSLTEEIVNPLVHLAHNHTSPSIERSVLLRMGFS
SIEASKIVIEGTKVNLLSKGMGNVVLKYSELKGIDYLDAGRMLGEGKGWNEVVELFRGDK
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaaaagagaagatgattttcaatcaagaaggcagcatttaaagaatttaagtgatgaa
gaattatatgaaagattttggtcgctaacagaagaaatagttaacccattagtacatctt
gctcataaccatacttctccatcaatagagcgttctgtactacttagaatgggattttca
agtatagaagcctctaaaatagttatagaaggtactaaggtaaatctactttctaaaggt
atgggaaatgtagtcctaaaatatagtgagcttaaaggtattgattatttagatgcagga
cgaatgctaggggaaggaaaaggatggaatgaagtagttgaactttttaggggggataag
taa

DBGET integrated database retrieval system