KEGG   Clostridium argentinense: RSJ17_08695
Entry
RSJ17_08695       CDS       T05123                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
carg  Clostridium argentinense
Pathway
carg00472  D-Arginine and D-ornithine metabolism
carg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:carg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    RSJ17_08695
Enzymes [BR:carg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     RSJ17_08695
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: ARC84603
Position
1764299..1766476
AA seq 725 aa
MLQENKKINVEEILKDLDKYKPKRRGWHWREKYDGNVGEFKYKEISASLKKSRALPSARS
FENIDPQPIPVITSEIASGRFEDDIRRMRMAAWHGADHIMVIRTAGQSHYDGLIEGSPEG
IGGVPITRKEVRATRKALDLIEEEVGREINFHSYVSGVAGPDIAVMFAEEGVNGAHQDPQ
YNVLYRNINMVRSFVDAAVAKKLMAWGEIVQIDGAHNANATAMKGYNVMPELMVQHAINS
KYSEKVGMKSENIALSTVPPTAPPAPCLTYDLPYAVALRDLFRNYKMRAQMNTKYMDSCT
REATVTHSLNLLISKLTSVDIQSTITPDEGRNVPWHYNNIHAVNTAKQALIGMDGLMDMV
ELKKDGYLPAKVRELKERAVLFLEEIIENGGYFEAVQKGFFVDSGEYPARNSDGIARKID
GGIGVDTVVKRDEDYFAPVCAHFGYNNVPEKHNKPCDAIKECTLCNHDKIQYIDELDEED
NVFRRMEKVKEDGTITPEVEWSKDGYVSVTLFLPESERIAEAAALEIGKNMNLTDVEVIH
KQVMQESEGTLVEIKGRVSFKIDKSKLKVPEKKQLLNDGVMKEYVQNNPVKIVAATVGED
EHSVGLREIIDIKHGGMERYGIECIYLGTSCPVEKLIDAAIETKAQAIVASTIITHNDVH
IKNMRKINDLCIEKGVRDKFILVSGGTQVSDEIAKANGMDAGFGRGTHGNDVASFIIETL
MKKEE
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgctacaagagaataaaaaaataaatgttgaagaaattcttaaagatttagataaatat
aagcctaaaagaagaggatggcattggcgggaaaaatatgatggaaatgttggggaattt
aaatataaagaaatttctgcttcccttaaaaaaagtagagctttaccatcagcaagaagc
tttgaaaatatcgaccctcaaccaataccagttataacttcagaaattgcctctggtaga
tttgaagatgatataagaagaatgaggatggctgcttggcatggagctgatcatataatg
gttataagaacagctgggcaaagtcattacgatggattaattgaaggttcaccagaaggg
ataggcggagttccaattacaagaaaagaagttagagctacaagaaaagctttagattta
attgaggaagaagtaggaagagaaataaactttcactcctatgtatctggtgtagccgga
ccagatattgcagttatgtttgcagaggaaggagtaaatggagcacaccaagatcctcaa
tataatgtgttatatagaaatataaatatggttcgttcctttgtagatgcagcagtagct
aaaaagcttatggcatggggagagattgttcaaatagatggagcacataatgctaatgca
actgctatgaaaggatataatgtaatgccagagcttatggttcagcatgctattaactct
aagtattctgaaaaagtaggaatgaagagtgagaatattgcactttcaacagttcctcct
acagcaccaccagcaccttgtttaacatatgaccttccatatgctgtagctcttagagat
ttatttagaaattataaaatgagagctcaaatgaatacaaaatacatggattcatgtaca
agagaagctactgttactcatagtttaaatttattaatctctaagcttacttcagtagat
attcaaagtacaataactcctgatgaaggaagaaatgtaccttggcattataataatatt
cacgctgttaatactgcaaagcaagcattaattggtatggatggcttaatggatatggtt
gagcttaaaaaagatgggtacttgccagcaaaggttagggaacttaaagaaagagcagta
ctattcttagaggaaataattgagaatggtggatattttgaagctgttcagaaaggattc
tttgttgattcaggggagtatccagctagaaacagtgatggtatagcaagaaaaattgat
ggaggtattggtgtagacacagtagttaaaagagatgaagattactttgcgccagtttgt
gctcattttggatataataatgttccagaaaaacataataaaccttgtgatgctataaag
gagtgtactctttgtaatcatgataaaattcaatatatagatgaattagatgaagaggac
aatgtttttaggagaatggaaaaagttaaagaagatggaactataaccccagaagttgag
tggagtaaagatggatatgtatcagtaaccttattcttacctgaaagtgagagaatagct
gaagctgctgcgttagaaataggaaaaaatatgaatttaactgatgttgaggttattcat
aaacaggtaatgcaagaatcagaaggtacattagttgaaataaaaggaagagtatccttt
aagattgataagagtaagctcaaagttccagagaaaaaacaacttttaaatgatggagtg
atgaaggaatacgttcaaaataatccagttaaaatagtagctgctactgttggagaggat
gaacattctgtaggactaagagaaattatagatattaaacatggaggtatggaaagatac
ggtatagaatgtatttatcttggaacttcttgtccagtagaaaaactgatagatgcggct
atagaaactaaagctcaagctatagttgcaagcacaataataactcataatgatgtacac
attaaaaatatgagaaagataaatgacctttgtatagaaaaaggtgtaagagataagttt
atattagtatctggaggaactcaggttagtgatgaaattgcaaaagcaaatggtatggat
gcaggttttggtagaggaacccatggtaatgatgtagcttcatttataattgaaactcta
atgaaaaaagaagaataa

DBGET integrated database retrieval system