KEGG   Clostridium argentinense: RSJ17_11865Help
Entry
RSJ17_11865       CDS       T05123                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
carg  Clostridium argentinense
Pathway
carg00260  Glycine, serine and threonine metabolism
carg01100  Metabolic pathways
carg01110  Biosynthesis of secondary metabolites
carg01120  Microbial metabolism in diverse environments
carg01130  Biosynthesis of antibiotics
carg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:carg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSJ17_11865
Enzymes [BR:carg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     RSJ17_11865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 OKR_DC_1 Aminotran_5 Cys_Met_Meta_PP Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ARC85141
Position
2481447..2482484
Genome map
AA seq 345 aa AA seqDB search
MRFIDLRSDTVTEPTDKMRKAMFEAIVGDDVYEDDPTVKELEQYAANLVDKEAALFVPSG
TFGNQLALFTHCNRGEEVILGDNCHIVAHEVGGASVIAGVQLRTIDNPKGILNTSEIEKR
IRKEEDIHFPNTSLICVENAHSSGVVVPLDNMGDIYNLAKKYNLKVHLDGARLFNAATYL
NVHPSEITKYTDSVMFCLSKALCAPIGSILAGSKEFIDKARKKRKLLGGGLRQSGFLAAA
GLVALKEMINPLKIDHENALLLADELEKIPGIEVNKKDIHINMVFFSLENTGIDGQTVVD
ELYKKGIKSNGEEDGLMRFVTHHWITKEDIYYTCDVLKDIINKNK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagatttatagatttaagaagtgatactgtaacagaacctaccgacaaaatgagaaaa
gctatgtttgaagctatagtaggagatgatgtttacgaagatgatcctactgttaaagaa
cttgaacaatatgccgctaacctagtagacaaggaagctgcattatttgttcctagtgga
acctttggaaatcaacttgcactttttactcactgtaatagaggtgaagaagtaatttta
ggagataattgtcatattgtagctcatgaagtaggaggcgcttctgtaattgcaggagtt
cagctaagaactatagataaccctaaaggcatattaaatacatctgaaattgagaaaaga
attagaaaagaagaggacattcattttcctaatactagtcttatttgtgttgaaaatgct
cattctagtggtgtagttgtacctttagataacatgggagatatttataatctagcaaaa
aaatataatcttaaagtacatttagatggagcaagattatttaatgctgctacttattta
aatgttcacccttcagaaattacaaaatacacagactcagtaatgttttgcttatctaaa
gcattatgtgctcctataggttctatattagcaggttctaaagaatttattgataaagct
agaaaaaaaagaaaactattaggtggaggattaagacaaagtggatttttagctgctgct
ggcttagtagctttgaaagaaatgattaaccctttaaaaattgatcatgaaaacgcatta
ttattagctgatgaacttgaaaaaattcctggtatcgaagttaataaaaaagatatacac
ataaatatggtattctttagcttagagaatactggaattgatggacaaacagtcgtagat
gaattatacaaaaaaggaattaaaagcaatggtgaagaagatggcttaatgagatttgtt
acccatcattggattactaaggaagatatttattatacttgtgacgtcttaaaagacatt
attaataaaaacaagtag

DBGET integrated database retrieval system