KEGG   Clostridium argentinense: RSJ17_16985Help
Entry
RSJ17_16985       CDS       T05123                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
carg  Clostridium argentinense
Pathway
carg00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:carg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    RSJ17_16985
Enzymes [BR:carg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     RSJ17_16985
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     RSJ17_16985
    1.1.1.-  
     RSJ17_16985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C PALP ADH_zinc_N_2 ApbA Oxidored_nitro Pyr_redox_3 2-Hacid_dh_C GP68
Motif
Other DBs
NCBI-ProteinID: ARC86065
Position
complement(3569504..3570583)
Genome map
AA seq 359 aa AA seqDB search
MKAALWYNKKDIRVEEIKEPKVTKGNVKIKVKWCGICGSDLHEYLGGPIFIPVGQPHPLS
GNVAPVVLGHEFSGEVVEVGEGVTKFKAGDRVTVEPIVACGKCPACRESKYNLCSSLGFH
GLCGSGGGLAEYTVFPEEFIHKIPDSMSYEQAALIEPMAVALHSIRISNFKTGDTAIVLG
SGPIGLATIECLKAAGTKLVVVLQRKSIRQEYAKRAGADVVLDPNEVDIAEEVKKLTNGI
GVDAAFETTGAKIGFDVGLNSLKYEGTLVVTSIWEEDVSFNPNALVFSEKKIVGTLAYRH
EFPATIAQMNDGRIKAEGYITKKIALEDIVEEGFGALTGPEKKKHVKILVTPDKSLLNE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcgttatggtacaataaaaaagatattagggttgaagaaataaaggaacca
aaggttactaaaggaaatgtaaagattaaagttaaatggtgtggaatatgtggttcagat
ttacatgaatatttaggaggacctatttttataccagttggacaaccacatcctttaagt
ggtaatgtggcaccagtagttctaggccatgaattttcaggagaggttgtagaagttgga
gaaggtgtaactaagtttaaagctggagatagagttactgtagagcctatagtagcgtgt
ggaaaatgcccagcttgtagagaaagtaaatataatctatgctcttcactaggattccat
ggactttgtggtagtggtggaggacttgcagaatatactgtatttccagaagaatttata
cataaaatacctgatagtatgtcttatgaacaggcagcattaatagaaccaatggctgta
gcgcttcattctattagaatttctaattttaaaacaggagatactgctattgtacttggt
tcaggaccaatagggcttgcaaccattgaatgtttaaaagcagcaggaacaaaattagta
gtagtgttacaaagaaaatcaattagacaagaatatgcaaagagagcaggagcagatgtt
gtacttgatccaaatgaagttgatatagctgaggaagttaaaaaacttactaatggaata
ggtgtagatgcagcatttgaaactacaggagcgaagataggctttgatgtaggattaaat
agcttaaagtatgaaggaactcttgtagtgacaagtatttgggaagaggatgtaagtttt
aatcctaatgccttagttttttctgaaaagaaaatagtaggtaccttagcttatagacat
gaatttccggcaacaattgcacaaatgaacgatgggagaattaaagcagaaggatatata
actaagaagatagctcttgaggatatagtagaagaaggttttggagctctaacaggtcct
gaaaagaaaaaacatgtaaagattcttgtaactccagataaatctcttttaaatgaataa

DBGET integrated database retrieval system