KEGG   Chryseobacterium arthrosphaerae: EGY05_01825Help
Entry
EGY05_01825       CDS       T05746                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase (quinone)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
carh  Chryseobacterium arthrosphaerae
Pathway
carh00020  Citrate cycle (TCA cycle)
carh00620  Pyruvate metabolism
carh01100  Metabolic pathways
carh01110  Biosynthesis of secondary metabolites
carh01120  Microbial metabolism in diverse environments
carh01130  Biosynthesis of antibiotics
carh01200  Carbon metabolism
Module
carh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
carh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:carh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EGY05_01825 (mqo)
   00620 Pyruvate metabolism
    EGY05_01825 (mqo)
Enzymes [BR:carh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     EGY05_01825 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase Pyr_redox_2 NAD_binding_8 DUF3322
Motif
Other DBs
NCBI-ProteinID: AYZ10757
Position
386382..387887
Genome map
AA seq 501 aa AA seqDB search
MSQSLTSRTPKPKYDVVLIGGGIMSATLATLLHEFDPNLEIAIFERLGRFAKESTAAWNN
AGTGHSAFCELNYTPEKPDGSIDIKKAESIAEQFEISKQFWAYLISKGYIHEPKDFINSC
PHMSLVFGEKDAEYLKKRHDKMTESVLFSGMEFSTDHEKLREWIPLVMSKRNKSEVMAAT
KMDMGTDVNFGTLTRKMGRHLLEDSNVEVFLYHEVKDIDPREDGKWGMKVKDRIHNHKQE
VVADFVFIGAGGYALPLLDSSDIKESEGYGGFPVSGQWLVTHNQELVEKHQAKVYTQATV
DAPPMSVPHLDLRIIDGQKALLFGPFAGFSTKFLKEGSYLDLPESVNTKNLKSLFGAWWH
NIPLTKYLIQQVAMTKAQRMQHLREFIKDAKEDDWELKVAGQRVQVIKKDEKEGGKLEFG
TEVVVNKAGTIASLLGASPGASTAVYAMLDVLEKCFPEKFHGEWKGKLLEMVPSYGQKLA
DNPELTQEVRNYTKEKLELEY
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaatcgcttacaagcagaacaccgaaacctaaatacgacgttgtactgatagga
ggcggaatcatgagcgccactttagcaacgctgcttcatgaatttgatcccaatctagaa
atcgctatcttcgaaagacttggaagatttgccaaggaaagtacagcagcatggaacaac
gccggaacagggcactccgctttttgtgagctaaattatacgccggaaaaaccagacgga
tccattgatatcaaaaaagcagaaagcattgcagagcagttcgaaatttcaaaacagttc
tgggcgtatctgatctccaaaggatatattcatgagcctaaagattttatcaactcatgc
ccgcatatgagtcttgtatttggagaaaaagacgcggaataccttaaaaagagacacgat
aaaatgacagaatcggttcttttctccggtatggaattttctactgatcatgaaaaactg
agagagtggattccgctggtcatgagcaaaagaaataaatctgaagtaatggcagccacg
aagatggacatgggaacagatgtgaacttcggaacactgaccagaaaaatgggaagacac
ctgcttgaagattccaatgtagaggtattcttatatcatgaagtaaaagacattgaccca
agagaagacggaaagtggggaatgaaagtgaaagacaggattcacaatcacaaacaggaa
gttgttgctgactttgtatttatcggtgccggcggatatgcgcttccgttactggacagc
tcagacatcaaagaaagtgaaggctatggaggcttcccggtttcaggacaatggctggta
acccataaccaggaattagtagaaaaacatcaggctaaagtatatacacaggctactgta
gatgcgccgccaatgtctgttcctcaccttgaccttaggatcattgatggccagaaagcc
cttcttttcggacctttcgcagggttctcaacaaaattcctgaaagaaggaagctacctg
gatcttccggaaagtgtgaataccaaaaacttaaaatcattattcggtgcatggtggcat
aatattccccttacaaaataccttattcagcaggttgccatgaccaaagctcagagaatg
cagcatttgagagaatttatcaaagatgccaaggaagatgattgggaactgaaagtagcc
ggacagagggttcaggtgattaaaaaagatgaaaaagaaggcggtaaacttgagttcgga
actgaagtggtagtcaataaagccggtaccatcgcatcgctgcttggagcttcaccgggg
gcatcaacagcagtatacgccatgctggacgttcttgaaaaatgtttccctgaaaaattc
catggcgaatggaaagggaagttactggaaatggtcccttcttacggccaaaaactggca
gacaacccggaacttacccaagaggtaagaaattacacgaaagaaaaactggaattagaa
tattaa

DBGET integrated database retrieval system