KEGG   Chryseobacterium arthrosphaerae: EGY05_10425Help
Entry
EGY05_10425       CDS       T05746                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
carh  Chryseobacterium arthrosphaerae
Pathway
carh00020  Citrate cycle (TCA cycle)
carh00310  Lysine degradation
carh00380  Tryptophan metabolism
carh01100  Metabolic pathways
carh01110  Biosynthesis of secondary metabolites
carh01120  Microbial metabolism in diverse environments
carh01130  Biosynthesis of antibiotics
carh01200  Carbon metabolism
Module
carh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
carh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:carh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EGY05_10425 (odhB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    EGY05_10425 (odhB)
   00380 Tryptophan metabolism
    EGY05_10425 (odhB)
Enzymes [BR:carh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     EGY05_10425 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H QRPTase_N RnfC_N
Motif
Other DBs
NCBI-ProteinID: AYZ12316
UniProt: A0A1B8ZR79
Position
complement(2237210..2238463)
Genome map
AA seq 417 aa AA seqDB search
MSVLEMKVPSPGESITEVEIATWLVKDGDYVEKDQPIAEVDSDKATLELPAEQSGVITLK
AEEGDVVQVGQVVCLIDMDAAKPEGAAPAAEAPKQEEAPKAAEPAKQEAPKPAAPAAAPQ
TYATGAPSPAAKKILDEKGMDAAQVSGTGRDGRITKTDAELAAVPALGGNPLTATGSRST
TTTKLSVLRRKIAQRLVSVKNETAMLTTFNEVDMSEIFRLRKQYKEEFAQKHGVGLGFMS
FFTKAVTRALQMYPDVNASIDGDFKVNYDFCDISIAVSGPKGLMVPVLRNAENMSFSAIE
ANIKDLATKVRDGKITVDEMTGGTFTITNGGTFGSMMSTPIINPPQSAILGMHNIIQRPV
AVDGQVVIRPMMYVAMSYDHRIIDGKESVGFLVAVKEGIDNPVEILMGGDERKGLGL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttttagaaatgaaagttccttcaccgggcgaatcaattacagaagttgaaatt
gcaacttggcttgtaaaagatggtgattatgtagaaaaagatcaacctatcgctgaagta
gactcagacaaagcaactcttgaattgccggcagaacaaagtggtgtgatcactttgaaa
gcagaagaaggtgatgtggtacaggtaggtcaggtagtttgtttaattgatatggatgct
gcaaaaccagaaggtgctgcacctgctgctgaagctccaaaacaggaagaagctccgaaa
gctgctgaacctgctaaacaggaagctccaaaaccagctgctccggctgctgctccacaa
acttatgctacaggagctccgtctccggctgctaagaaaatccttgacgaaaaaggaatg
gatgctgctcaggtttcaggaacaggaagagacggaagaatcactaaaactgatgctgaa
ttggctgcagttcctgcattaggaggaaatccgcttacagcaacaggttcaagatctaca
acaacaaccaagctttcagttttaagaagaaaaatcgctcagagattagtttctgtgaag
aatgaaacagcaatgttaacaactttcaacgaagttgacatgtctgaaatcttcagatta
agaaagcaatataaagaggaatttgctcagaaacacggagtaggacttggtttcatgtct
ttctttacaaaagcggtaacaagagcattacaaatgtatccggatgtaaatgcatccatc
gacggagacttcaaagtaaactatgatttctgcgatatttcaattgcagtttccggtcct
aaaggattaatggtgcctgtattgagaaatgcagaaaacatgtctttcagtgctattgaa
gccaacatcaaggatcttgctacaaaagtaagagacggtaaaattactgttgacgaaatg
acgggtggtactttcacgattacaaacggtggtactttcggatctatgatgtctacacca
attatcaaccctccgcaatctgcaatccttggaatgcacaatattatccagagaccggtt
gctgttgacggacaggttgtaatcagaccaatgatgtacgttgccatgtcttatgaccac
agaattatcgacggaaaagagtctgtaggattccttgtagcggtaaaagaaggtatcgac
aatcctgttgaaattttaatgggaggtgacgaaagaaaaggccttggattatag

DBGET integrated database retrieval system