KEGG   Chryseobacterium arthrosphaerae: EGY05_12095Help
Entry
EGY05_12095       CDS       T05746                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
carh  Chryseobacterium arthrosphaerae
Pathway
carh00020  Citrate cycle (TCA cycle)
carh00480  Glutathione metabolism
carh01100  Metabolic pathways
carh01110  Biosynthesis of secondary metabolites
carh01120  Microbial metabolism in diverse environments
carh01130  Biosynthesis of antibiotics
carh01200  Carbon metabolism
carh01210  2-Oxocarboxylic acid metabolism
carh01230  Biosynthesis of amino acids
Module
carh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
carh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:carh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EGY05_12095
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EGY05_12095
Enzymes [BR:carh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     EGY05_12095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AYZ12620
Position
2578039..2580258
Genome map
AA seq 739 aa AA seqDB search
MSEKSKIYYTLTDEAPMLATHSFLPIVKAFTKSADIEIAVPDISLAGRILANFPEFLKDD
QKIGDALAELGELATQPDANIIKLPNISASVPQLDAAIAELQAKGFAVPNYPAEPKNDEE
KAIKAKYAKVLGSAVNPVLREGNSDRRAPKAVKNYAKANPHRMGDWASDSKTDVAHMNNG
DFYGTETSTTLENATKYRIVFKGNDGSENVLKDFAALQAGEVIDSSVMNLKALKVFVQEA
IEEAKKRNVLLSAHLKATMMKISDPIIFGAIVETFFKDVFTKYAETFKSLDINPNNGLAD
LFEKIKGNAQEADIKADIEKALAEGPRVAMVNSDKGITNFHVPSDIIVDASMAALVRGGG
KMWNKDGNEEDTVCIIPDRSYAGFYQSVIDDMKAHGKLDPTTMGSVPNVGLMAQKAEEYG
SHDKTFQLSADGTVEVQDEAGNVLLSQKVEKDDIFRMCQTKDAPIQDWVKLAVNRSRLSD
TPAIFWLDKGRAHDREIIKKVEKYLADHDTAGLDIRILDVKDAMTETLRRAREGKDTISV
SGNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVEQFLEEGYLRW
DSLGEFLALQASLEHLAQTQGNTKSQVLADALDEANAKFLATDKSPARKVGQIDNRGSHF
YLAMYWAEALANQTADAELAAQFAPVAQAMHENEEVINAELIGAQGKPQNIDGYYKTDTY
KTYEAMRPSTVLNEIIDGI
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaaatcaaaaatctattacacacttactgatgaagctccaatgctggctaca
cactcgtttttaccgattgtaaaagctttcaccaaatcagcagatattgagatcgcagtt
ccggatatttctttggcaggaagaattttagctaatttccctgaatttttaaaggatgac
cagaaaattggtgatgctttggctgaattgggagaattagcaacccaaccagatgccaat
atcattaaattacctaatatttcggcttctgttcctcaattggacgcagctattgctgaa
ttacaagctaaaggttttgcagttcccaattaccctgcagagcctaagaatgacgaagaa
aaagcaatcaaagcgaagtatgccaaagtattaggaagtgctgtaaaccctgtattaaga
gaaggaaactctgacagacgtgctccgaaagctgttaaaaactatgctaaagcaaaccct
cacagaatgggtgactgggcatctgacagcaaaactgacgtagctcacatgaataacggt
gatttctacggaacagaaacttctacaacattagaaaatgctacaaaatacagaatcgta
ttcaaaggaaatgacggttctgaaaatgtattgaaagacttcgcagctcttcaggccggt
gaggtgatcgattcttctgtaatgaacttaaaagcattaaaagtatttgtacaggaagca
atcgaggaagctaagaaaagaaatgtacttctttctgcccaccttaaagctacaatgatg
aaaatctccgaccctattattttcggggctatcgtagaaactttcttcaaagatgtattc
actaaatatgctgagactttcaaatctttagatatcaacccgaataacggtctggctgat
cttttcgaaaaaatcaaaggaaatgctcaggaagctgacattaaagctgatattgaaaaa
gcgcttgcggaaggaccaagagtggctatggtaaattctgataaaggaattaccaacttc
catgtaccttctgacatcatcgttgacgcgtctatggctgctttggtaagaggcggaggt
aaaatgtggaacaaagacggaaatgaggaagataccgtttgtatcatccctgaccgttct
tacgcaggtttctaccagtctgtaattgacgatatgaaagcgcacggaaagcttgaccct
actacaatgggatctgttccaaacgttggattaatggctcagaaagctgaagaatacggt
tctcacgacaaaactttccaactgtctgctgacggaacagtagaagttcaggatgaagca
ggaaatgttcttctttctcagaaagtagaaaaagatgacatcttcagaatgtgtcagact
aaagatgctcctatccaggattgggtaaaactggcggtaaacagatccagattatctgat
actcctgctattttctggctggataaaggaagagctcacgacagagaaatcattaaaaaa
gtagaaaaataccttgctgatcacgatactgcaggtcttgacatcagaattcttgatgta
aaagatgctatgactgagactttaagaagagcaagagaaggaaaagatacaatctcagtt
tcaggaaatgtattgagagattatcttactgaccttttcccgattctggaacttggtact
tctgcaaaaatgctttctatcgttccattgatgaacggtggtggtctgtttgaaacaggg
gccggaggttctgctccgaaacacgttgagcagttccttgaagaaggttatttaagatgg
gattctctgggagaattcctagcacttcaggcgtctttagaacatttagcacagactcag
ggcaatacaaaatctcaggttctggctgatgcgttggatgaggcaaatgctaaattctta
gcgacagacaaatctcctgcaagaaaagtaggacaaattgataacagaggttctcacttc
tacctggccatgtattgggctgaagcgctggctaaccagactgccgatgctgaattggct
gctcagtttgctccggttgcacaggcaatgcatgaaaatgaagaggtcatcaatgctgaa
ttaattggggctcagggtaaacctcagaatattgacgggtactacaaaaccgacacttat
aagacgtatgaggctatgagaccaagtacggttctaaatgaaatcattgacgggatctaa

DBGET integrated database retrieval system