KEGG   Cryobacterium arcticum: PA27867_0239Help
Entry
PA27867_0239      CDS       T04435                                 

Definition
(GenBank) O-succinylbenzoate synthase
  KO
K02549  O-succinylbenzoate synthase [EC:4.2.1.113]
Organism
cart  Cryobacterium arcticum
Pathway
cart00130  Ubiquinone and other terpenoid-quinone biosynthesis
cart01100  Metabolic pathways
cart01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cart00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    PA27867_0239
Enzymes [BR:cart01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     PA27867_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C Enolase_like_N
Motif
Other DBs
NCBI-ProteinID: ANP71213
UniProt: A0A1B1BFC1
Position
1:complement(259941..260921)
Genome map
AA seq 326 aa AA seqDB search
MLPSLHDVLATARVVDLPLVTRFRGLTSREAVLIEGPAGWCEFSPFVEYDDEEAAAWLRA
ALEFGWQETPALLRDRVPVNATVPAIDADAVPALLARFPGCRTAKVKVADPGQTLAEDVE
RVRAVRRVLGPEGRIRVDANGLWNLDEAEHAIHALAEFDLEYVEQPCASIDELAEIRRRT
DYLDLPIAADESVRKQADPLLVSRSGAADLLVVKVQPLGGIRAVLAIQAETGLPLIVSSA
LDTSVGISMGAFLAGALPELDYDCGLATASLLAADVTHDPLLPVGGSIPVRRVVPDADLL
DTYAASAERRDWWLARITRVHALLAD
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctcccctcactgcacgacgtgctcgccaccgcccgcgtggtcgacctccccctcgtc
acccgttttcgcggcctcacgagccgggaagccgtgctgatcgagggcccggccggctgg
tgcgagttctcccccttcgtcgagtacgacgacgaggaggccgccgcctggctgcgggca
gcactggagttcggttggcaggagaccccggcgctcttgcgcgaccgggtgccagtcaac
gcgacggtcccggccatcgacgcggacgccgtccccgccctgttggcccgcttccccggg
tgccgcaccgccaaggtgaaggtcgccgatcccggccagaccctcgccgaagacgtggag
cgtgtgcgcgccgtgcgccgggtgctcggcccggagggacgcatccgtgtcgacgcgaac
gggctgtggaacctcgacgaagccgaacacgccattcacgctttggccgagttcgacctc
gagtacgtggagcagccctgcgcgtcgatcgacgaactcgccgagatccgccgccgcacc
gactacctcgacctgccgatcgcggccgacgagagcgtgcgcaagcaggccgatccgctc
ctggtgtcgcgctcgggagccgcggacctgctcgtggtcaaggtgcagccgctcggcggc
atccgtgcggtgctggccattcaggccgagaccggcctgcccctcatcgtctccagcgcc
ctcgacacctcggtgggtatctccatgggtgcgttcctggccggggcgttgcccgagctg
gactacgactgcggcctggccacggcgtcgttgctggccgccgatgtcacccacgacccg
ctgctgccggtcggtggcagcatcccggttcgtcgcgtggtgccggatgccgacctgctg
gacacctatgccgcgagcgccgagcgccgcgactggtggctcgcccggatcacccgcgtg
cacgcgctcctcgccgactga

DBGET integrated database retrieval system