KEGG   Cryobacterium arcticum: PA27867_0405Help
Entry
PA27867_0405      CDS       T04435                                 

Definition
(GenBank) beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
cart  Cryobacterium arcticum
Pathway
cart00460  Cyanoamino acid metabolism
cart00500  Starch and sucrose metabolism
cart01100  Metabolic pathways
cart01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cart00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PA27867_0405
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    PA27867_0405
Enzymes [BR:cart01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     PA27867_0405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: ANP71378
UniProt: A0A1B1BFP7
Position
1:453617..455074
Genome map
AA seq 485 aa AA seqDB search
MTSTTAPTASAGNPDYRDSGLVFPESFLFGSATASYQIEGAFDEDGRGPSIWDTFSHTPG
KVWNGDTGDVAADHYHRLEADLDLMTSLGLAAYRFSIAWSRIQPTGRGPANQAGLDFYGR
LIDGLIARGIRPIVTMYHWDLPQALEDEGGWTNRATAYAFADYAAILGREFGDRVDTWTT
LNEPWCSAYLGYGSGAHAPGRTDGAEALTAVHHLNLAHGLAIQALKPLVTNDPDFSITLN
LHVIRGEGETGPEAVRQIDALANRVFLGPLLTGAYPADVFEDTKGITDWAFILPGDTEII
HQPLDVLGVNYYSTTLVRMWDGVSPRENSDGHKDVGASPWPGADQVEFLAQPGPYTEMGW
NIEPAGLEELLVALHEEFPNQPLMVTENGAAFADEVVQTEDGPRVHDVERTDYLRRHFTA
AHRAMARGVDLRGYQVWSLMDNFEWGYGYSKRFGIIHVDYDTLVRTPKDSAHWYAALVAT
HTLPA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccaccgcccccaccgcgtccgcgggcaaccccgactaccgcgactccggc
ctcgtgttccccgagtcgttcctcttcggttccgccaccgccagctaccagatcgagggc
gccttcgacgaagacggtcgcgggccttccatctgggacaccttcagccacaccccgggc
aaggtctggaacggtgacacgggcgatgtcgccgccgaccactaccaccggctcgaggcc
gacctcgacctgatgacgtcgctgggcctggccgcgtaccgcttctcgatcgcctggtcg
cgcatccagcccaccggtcgtggcccggccaaccaggccggactcgacttctacgggcgc
ctgatcgacggtctgatcgcccgcggcatccgcccgatcgtcaccatgtaccactgggac
ctgccccaggcgctggaggacgagggcggttggaccaaccgggccacggcctacgcgttc
gccgactacgcggcgatcctcgggcgcgagttcggtgaccgggtcgacacctggaccacc
ctgaacgagccgtggtgctccgcctacctgggctatggctccggcgcgcacgcgcccggc
cgtaccgacggcgccgaggccctcaccgcggtccaccacctcaacctggcccacggcctg
gccatccaggcgctgaagcccctggtcaccaacgaccccgacttctcgatcacgctcaac
ctgcacgtcatccgtggcgagggcgagaccgggccggaggccgtgcggcagatcgacgcg
ctggccaaccgggtgttcctcggcccgctgctgaccggcgcatacccggcggatgtcttc
gaagacactaagggcatcaccgactgggcgttcatcctgcccggcgacacggagatcatc
caccagccgctggacgtgctcggggtcaactactactccaccaccctggtgcggatgtgg
gacggcgtctcgccccgcgagaactccgacggtcacaaggacgtcggcgcatcaccgtgg
cccggcgccgaccaggtcgagttcctcgcccagcccggcccgtacaccgagatgggttgg
aacatcgaaccggccggcctcgaggaactgctcgtggccctgcacgaggagttcccgaac
cagccgctgatggtcaccgagaacggtgccgcgttcgcggacgaggttgtacagaccgag
gacggcccccgcgtgcacgacgtggagcgcaccgactacctgcgccggcacttcaccgcc
gcgcaccgggcgatggcccgcggcgtggacctgcgcggctaccaggtgtggtcgctgatg
gacaacttcgagtggggctacggctactccaagcggttcggcatcatccacgtggactac
gacaccctggtgcgcacccccaaggacagcgcgcactggtacgccgccctggtcgccacc
cacaccctccccgcctaa

DBGET integrated database retrieval system