KEGG   Cryobacterium arcticum: PA27867_2931Help
Entry
PA27867_2931      CDS       T04435                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
cart  Cryobacterium arcticum
Pathway
cart00051  Fructose and mannose metabolism
cart01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cart00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PA27867_2931
Enzymes [BR:cart01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     PA27867_2931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N ApbA
Motif
Other DBs
NCBI-ProteinID: ANP73868
UniProt: A0A1B1BMT3
Position
1:complement(3258009..3259160)
Genome map
AA seq 383 aa AA seqDB search
MKAIHFGAGNIGRGFVGLLLHEAGYEVVFADVNAPLIEALQGAPSYTVHEAGETPTDKLV
DNFRAINSSTHEADLINEIATADAVTTAVGPNVLRFVAPVIAAGLARRDAGRPPLAVMAC
ENAINATDVLAEQVWANVPDGDRDALASRVAFANTAVDRIVPGQAADAGIDVTVEAFYEW
VIESPAFGDTPPVIPGATFVKDLAPYIERKLFTVNTGHATVAYLGTQAGVSKLSDALLVP
SVADGARRVLEETSALLVAKHGLDEDTQRAYREKILGRFANPSLPDTVERVGRQPLRKLS
RHERFIGPAAEIAERGTRPVALLEAIAAALRFNVADDEQSVELQRMLATDSAETIVADVC
GLEPTHPLYADVLEVVRGAVTAS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccattcacttcggcgcgggcaacatcggccgcggtttcgtcgggctcctgctt
cacgaggccggttatgaggtcgtcttcgccgatgtgaatgctcctctcattgaggctctg
cagggcgcaccgtcctacacggtgcacgaggcgggggagacgcccaccgacaagctggtc
gacaacttccgcgccatcaacagttccacccacgaggccgatctcatcaacgagatcgcc
acggccgacgcggtcaccaccgccgtcggaccgaacgtgttgcgtttcgtggctccggtc
atcgcggcgggcctggcccgccgcgatgccggccgcccgccgctggccgtgatggcctgc
gagaacgcgatcaacgccacggatgtgctcgccgagcaggtctgggcgaacgtgcccgac
ggcgaccgcgacgccctcgccagccgggtggccttcgcgaacacggccgtggaccgcatc
gttcccggccaggcagcggatgccggtatcgacgtcaccgtcgaggccttctacgagtgg
gtcatcgaaagccccgccttcggcgacaccccgccggtgatccccggcgccacgttcgtc
aaggacctcgccccgtacatcgagcggaagctcttcacggtgaacaccgggcacgccacg
gtggcctacctcggcacccaggccggcgtctccaagctctccgacgccctgctggtgccc
tcggtcgccgacggtgcccgacgggtgctcgaagagaccagcgccctcctggtggccaag
cacggcctcgacgaagacacccagcgcgcctaccgggagaagatcctcggtcggttcgcc
aacccgtcgctgcccgacaccgtcgaacgtgtcggccgccagccgctgcgcaagctcagc
cggcacgaacgcttcatcggcccggccgccgagatcgccgagcggggcacccgccccgtg
gcgctgctcgaggccatcgccgccgcgctgcgcttcaacgtggccgacgacgagcagagc
gtcgaactgcagcggatgctcgccaccgactcggccgagaccatcgtggccgacgtgtgc
gggctcgagcccacgcatccgctctacgcggacgtgctcgaggttgtccgcggagccgtc
accgcatcctga

DBGET integrated database retrieval system