KEGG   Cryobacterium arcticum: PA27867_2955Help
Entry
PA27867_2955      CDS       T04435                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cart  Cryobacterium arcticum
Pathway
cart03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cart00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PA27867_2955
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cart03011]
    PA27867_2955
Ribosome [BR:cart03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    PA27867_2955
  Bacteria
    PA27867_2955
  Archaea
    PA27867_2955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ANP73892
UniProt: A0A1B1BMK7
Position
1:complement(3276165..3276530)
Genome map
AA seq 121 aa AA seqDB search
MVESIARVRHIRVTAQKARRVVNLIRGKQAHEALGILKFAPQGASDPVYKLVESAIANAR
VKADAANEFLDEQDLFISQAFVDEGTTLKRFQARAQGRAFQIKKRTSHITVVLATPEEGT
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggtggagtcgatcgcacgcgtgcgtcacatccgcgttaccgcccagaaggcccgtcgc
gttgtcaacctgattcgtggcaagcaggcgcacgaagcgctgggaattctgaagttcgcg
ccgcagggcgcgtccgaccccgtgtacaagctggtcgaatcggccatcgcgaacgcccgg
gtcaaggcagatgcagcgaacgagttcctggacgaacaggatctgttcatctcccaggca
ttcgtcgatgagggcacgaccctcaagcgtttccaggcccgcgcacagggtcgcgcattc
cagatcaagaagcgtacgagccacatcactgttgtgctcgccactcctgaggagggtacg
aagtaa

DBGET integrated database retrieval system