KEGG   Croceibacter atlanticus: CA2559_07020Help
Entry
CA2559_07020      CDS       T01256                                 

Definition
(GenBank) leucyl aminopeptidase
  KO
K05994  bacterial leucyl aminopeptidase [EC:3.4.11.10]
Organism
cat  Croceibacter atlanticus
Brite
KEGG Orthology (KO) [BR:cat00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cat01002]
    CA2559_07020
Enzymes [BR:cat01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.10  bacterial leucyl aminopeptidase
     CA2559_07020
Peptidases [BR:cat01002]
 Metallo Peptidases
  Family M28: aminopeptidase Y family
   CA2559_07020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M28 Peptidase_M20 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: EAP88493
UniProt: A3U8C6
Position
1564792..1566243
Genome map
AA seq 483 aa AA seqDB search
MKYVLAIVLNLGVFFSLYAQNDSPFYATLNKEDASTLKLQFPDAVQILGSTEYESAVMLT
ETAAHELHDAILVHGPGYIRKPSAEKALNDIAATPLIPNAQSFTSTNYTITHDAIVTQAL
NEVSTSNLEDHIIELQNYGTRYHNRPEGTQAAMDLKAKWEALAASYNRTDVSVRLFNHTG
TTMPSVIMTITGAVSPNEYVITGGHLDTTASVNALAPGADDDASGIATITEAARVLFEID
FVPNRTIEIMAYAAEEIGLVGSAEIAQTYSSDNKNVIGVTQFDMTNFNGSDNDVYFITDN
TDTSLNSFLMQLLDNYNADGVHQVTYGTSLCNYGCSDHASWFAQGYPASFPFEAAFGEHN
QAIHTLGDTFTVSGTADHATKFTKLCTEFLIETAKTSVLGVTEFNQPNVITTVNDNVLSY
RFESSDFTVESLSIYDISGKKLTFENLDGNTGNYDLNSLSTGLYIASFKIKNQGVFSKKI
SVE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgtattagccatagtattaaacttaggtgtgttttttagcttgtatgctcaa
aatgactcaccattttacgcaaccttaaataaggaagatgcaagcacattaaagcttcaa
tttccagatgctgtacaaatattaggatcaacagaatatgagtctgcagttatgctaacc
gagactgcagctcatgaattacatgatgctatattggtacacggaccaggatatattaga
aagccttctgcagagaaggctttaaatgatatcgctgcaacaccactaattccaaatgca
caatcgtttacaagcactaactatacaattacacatgatgctatagttacacaagcttta
aatgaagtaagcacatcgaatttagaagatcatattatagagttgcaaaattatggtacc
agataccataacagaccagaaggaacacaagctgctatggatttaaaagcaaaatgggaa
gcattagcagcaagttataaccgtacagatgtctctgtgagattatttaaccatacaggg
accacaatgccgtctgttataatgaccattacaggtgctgtatctccaaatgagtatgta
attactggaggtcatttagatacaacagcaagtgtaaatgcgttggcgccaggtgcagat
gatgatgcctcaggtattgctacaattactgaagctgctcgtgttttattcgaaatagat
tttgtgcctaaccgtaccattgaaattatggcatatgctgcagaagagataggtttagtt
ggttctgcagaaattgcacaaacttatagtagcgacaataaaaatgtaattggtgtcact
caatttgatatgacaaattttaatggctcagacaacgatgtttattttataacagataat
acagatacatcattaaattcatttttaatgcaattgttagacaactataatgcagatggc
gtacaccaagttacttacggtacatcgttatgtaattatggatgttcagaccacgcaagt
tggtttgcacaaggctacccagcatctttcccctttgaagctgcttttggagaacataac
caagctattcataccttaggagatacgtttacagtttctggtaccgcagatcacgctacg
aaattcacaaaactttgtacagagtttttaattgaaacagcaaaaacttcagtattaggc
gttacagagtttaatcagccaaatgttataacaactgtaaatgataatgttttgagttat
agatttgaatcctcagactttactgtcgaatcactttctatctacgacattagtggaaaa
aagctaacgtttgagaatcttgatgggaatacaggaaattatgatttaaactcgctaagt
acaggattgtatatagcaagttttaagattaaaaatcaaggagttttttctaaaaaaatt
agtgtagagtaa

DBGET integrated database retrieval system