KEGG   Croceibacter atlanticus: CA2559_07590Help
Entry
CA2559_07590      CDS       T01256                                 

Definition
(GenBank) lipoamide acyltransferase component of branched-chain alpha-ketoacid dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cat  Croceibacter atlanticus
Pathway
cat00020  Citrate cycle (TCA cycle)
cat00310  Lysine degradation
cat01100  Metabolic pathways
cat01110  Biosynthesis of secondary metabolites
cat01120  Microbial metabolism in diverse environments
cat01130  Biosynthesis of antibiotics
cat01200  Carbon metabolism
Module
cat_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cat_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CA2559_07590
  Amino acid metabolism
   00310 Lysine degradation
    CA2559_07590
Enzymes [BR:cat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CA2559_07590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: EAP88607
UniProt: A3U8P0
Position
1687184..1688506
Genome map
AA seq 440 aa AA seqDB search
MAKFELKLPQMGESVAEATLTNWLKEVGDTIEADEAVLEIATDKVDSEVPSEVDGVLVEK
LFEADDVVQVGQTIAIIETEGGDAPAETTSSETPAKEESSKKAVEAVSQSVTSAKEATTT
DFSESDKFYSPLVKNIAKEEGVSLSELDAISGTGKDERVTKNDILKYIEDKKAGKTAAPK
PQMQPVETSKTAAPKPPKAPVSVNGGDEIIEMSRMGKLIAHHMVDSVQTSAHVQSFIEVD
VTNIWNWRNKIKNEYQKREGEKLTFTPIFMEAVAKTIKDFPMINISVDGDKIIKRKAINL
GMAAALPDGNLIVPVIKNADQLNLVGMSKSVNDLANRARIGKLKPDDTQGGTYTVTNVGT
FGSVFGTPVINQPQVAILALGAIRKVPAVIETPDGDFIGIRYKMFLSHSYDHRVVNGALG
GQFVQRVKDYLEAFDVNREI
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtttgaactaaagctcccgcaaatgggtgagagtgttgcagaagcaacctta
actaactggcttaaagaagttggtgatactatagaggctgatgaggctgtcttagaaatc
gcaacagataaagttgacagcgaagtaccaagtgaggtagatggtgttttggttgaaaag
ctttttgaagcagatgacgttgtgcaagtaggacagactatcgcaataattgaaactgaa
ggtggagatgctcctgctgaaacaacttcatcagaaacgccggctaaagaagagtcgtct
aaaaaagctgttgaagctgtatcacaatctgtaacttctgcaaaagaagcaacaactaca
gatttttcagaatctgataaattttattctccacttgttaagaatatagcaaaagaagaa
ggtgtatcattatctgagctagatgcaatatctggtacaggtaaagatgaacgtgttact
aaaaatgacattttaaaatacattgaagataaaaaagcaggtaagactgctgctcctaaa
ccacaaatgcaacctgtagaaacatctaagacagctgctccaaaacctcctaaagctcct
gtaagtgtaaatggtggcgatgagattattgaaatgtctcgtatgggtaaactaattgct
catcatatggtagacagtgtgcaaacatctgcgcacgtacagtctttcatagaggtagat
gttacaaacatctggaactggagaaacaaaattaaaaatgaataccaaaaacgagaaggt
gaaaaactaacgtttacaccaatctttatggaagctgtagctaagactataaaagacttc
ccaatgattaatatctctgtagatggtgataaaattataaagcgtaaagctattaacctt
ggtatggcagctgcattaccagatggtaacctaattgtgccagttataaaaaatgcagac
cagctaaacttggtaggtatgtctaaatctgttaatgatttggctaaccgtgcacgtatt
ggaaaattaaaaccagacgatacacaaggtggtacatacacagtaacaaatgttggtaca
tttggtagtgtgtttggtactcctgtaataaaccaacctcaagttgcaattttagcgcta
ggtgctattagaaaagtaccagctgtaattgaaactccagatggtgactttataggaata
cgttataaaatgttcttgtcgcactcttatgatcatcgcgttgtaaatggtgcattagga
ggacaatttgttcaacgtgttaaagattatttagaagcgtttgatgtgaatagagaaatc
taa

DBGET integrated database retrieval system