KEGG   Croceibacter atlanticus: CA2559_11183Help
Entry
CA2559_11183      CDS       T01256                                 

Definition
(GenBank) pterin-4a-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
cat  Croceibacter atlanticus
Pathway
cat00790  Folate biosynthesis
cat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CA2559_11183
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cat04147]
    CA2559_11183
Enzymes [BR:cat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     CA2559_11183
Exosome [BR:cat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CA2559_11183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a IF-2 Sun2_CC2
Motif
Other DBs
NCBI-ProteinID: EAP86595
UniProt: A3U9V9
Position
2431338..2431622
Genome map
AA seq 94 aa AA seqDB search
MKLTEQQIENALKELKGWEFGDDAIHTSFEFNNFKEAFSVMTRIAFEAEAQQHHPEWTNV
YNELSITLSTHDAGGVTEKDIEMAKTIEDIIDAD
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttacagaacaacaaatagaaaacgcattaaaagaattaaaaggttgggaattt
ggagatgatgccatccatacatcttttgagtttaataattttaaagaagcttttagtgta
atgacaagaatagcttttgaagcagaagcacaacaacatcatccagaatggacaaatgtt
tataatgaactttctataacgttaagtacacatgatgctggtggcgtaacagaaaaagat
atcgagatggctaaaaccattgaagatataattgacgcagactaa

DBGET integrated database retrieval system