KEGG   Catenovulum sp. CCB-QB4: C2869_00870Help
Entry
C2869_00870       CDS       T05408                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
cate  Catenovulum sp. CCB-QB4
Pathway
cate00620  Pyruvate metabolism
cate00630  Glyoxylate and dicarboxylate metabolism
cate01100  Metabolic pathways
cate01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cate00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C2869_00870
   00630 Glyoxylate and dicarboxylate metabolism
    C2869_00870
Enzymes [BR:cate01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     C2869_00870
    1.2.1.22  lactaldehyde dehydrogenase
     C2869_00870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AWB65081
UniProt: A0A2S0VLK3
Position
242837..244300
Genome map
AA seq 487 aa AA seqDB search
MNFQNLSFQNNVNFINGEYVKSAADGVIEVLSPSTGEKIGEIPRGCAEDAQHVLEVADVA
QKAWAKKTARQRQAILRVFAQKIRENKDILAPMLVAEQGKLISVAEMEVDVTATFIEYAC
DHALTIEGDILPSDNEDEKIYIHKVPRGVVVGITAWNFPLALAGRKIGPALITGNSIVLK
PTQETPLATTELGRIANEAGLPAGVLNVINGSGSVVGQSLCENPITKMITMTGSTVAGKK
IYETSANYMTPVMLELGGKAPMVVMEDADIDQAVEGALWGRFANCGQVCTCVERLYLHEA
IYDKFMDKFLPLVEGLKVGDPMNPETQMGPKCNQREIDNIDHIVQESIKQGAKVATGGKT
ASVEGFEGGCWYEPTVLVDVAQDNIAVHEETFGPILPIVKVKDMDQAIEFCNDSIYGLSA
YVYSSNFFEINKAINDLEVGEVYVNRGMGEQHQGFHNGWKQSGFGGEDGKFGLEQYLEKK
TVYLKEK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccaaaacctttcgtttcaaaacaatgtaaattttattaatggcgaatacgtt
aaatcagcagccgatggcgtaatagaagtattaagcccatcaactggtgaaaaaattggt
gagatcccacgtgggtgtgcagaagatgcacaacacgtattggaagtggctgatgttgca
caaaaagcatgggctaagaaaaccgctcgtcaacgccaagctattcttcgtgtttttgca
caaaaaattcgcgaaaacaaagacattcttgcgccaatgctagtcgctgagcaaggtaaa
ctgatttcagttgctgaaatggaagttgacgttacggctacttttattgaatacgcttgt
gaccacgcgttaaccattgaaggtgatattcttccttcagataacgaagatgagaaaatc
tacatccacaaagtaccacgtggtgtcgttgttggtattacagcttggaacttccctcta
gctctagcgggtcgtaaaattggtccagcattaattactggtaactcaattgttcttaag
ccaacacaagaaacaccattagcaacaactgaattaggtcgtatcgccaatgaagctggt
cttcctgctggtgtgttaaatgtgatcaacggttctggctcggttgtcggtcagtcttta
tgtgaaaacccaatcactaagatgatcactatgacaggttcaactgttgctggtaagaaa
atttatgaaaccagcgctaactacatgacaccagttatgttagagcttggcggtaaagca
cctatggttgtaatggaagatgccgatatcgaccaagccgttgaaggcgcattatggggc
cgttttgctaactgtggtcaggtttgtacttgtgttgagcgtttatatcttcacgaagct
atctatgacaagtttatggacaagttcttaccattagttgaaggccttaaagttggtgac
cctatgaacccagaaacgcaaatgggtcctaagtgtaaccaacgtgaaatcgacaatatt
gatcatattgttcaagaaagtatcaagcaaggcgctaaagttgcgactggtggtaaaaca
gcatcagttgaaggttttgaaggcggttgctggtacgagccaacagtattagtagatgtt
gcgcaagacaatattgcagtacacgaagaaacatttggtcctatcttacctatcgttaag
gtaaaagatatggatcaagctatcgagttctgtaacgacagcatctatggcttaagtgct
tatgtttattcttcaaacttcttcgaaatcaataaagcaatcaatgatttagaagtaggt
gaagtttacgtaaaccgtggtatgggtgagcaacaccaaggtttccacaatggttggaaa
caaagcggtttcggcggcgaagacggtaaattcggtttagagcagtacttagagaagaaa
accgtttacttaaaagagaagtaa

DBGET integrated database retrieval system