KEGG   Catenovulum sp. CCB-QB4: C2869_01540Help
Entry
C2869_01540       CDS       T05408                                 

Definition
(GenBank) hypothetical protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
cate  Catenovulum sp. CCB-QB4
Pathway
cate00860  Porphyrin and chlorophyll metabolism
cate01100  Metabolic pathways
Module
cate_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:cate00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C2869_01540
Enzymes [BR:cate01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     C2869_01540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AWB65205
UniProt: A0A2S0VLY7
Position
complement(414795..415643)
Genome map
AA seq 282 aa AA seqDB search
MTQTTVLTQQAQAQAQAKPRKIQITLVRHPKVDGAAGLYGATDIAAQPEAAEHLNQQIML
RLSQARQVEQDEQKPAAFERCRLFSSPKKRCLSVAEQVVKQVNCDNENKMQLEVIDDLAE
MDFGCYDGVAFESIPADSAKWQELENFWQNPAETVLPQAETLQSFHTRIINAWHKVLAKL
QQSECSHALLVVHGGVIRMILSHILDLDWRNAKLYSQLVIDYASFTELSVTVHPDCKPFV
RVKAIGTKPTALNNSVLNHSVLGHSELSHSLINKKQGAKGAS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaacaactgtacttacacaacaagctcaagctcaagcccaagccaaaccacgt
aaaattcaaattactttggtgcgccatccaaaagttgatggtgcagccggtttatatggt
gcaactgatattgccgcgcaaccagaagcggcagaacacttgaaccagcaaattatgctg
cggttaagccaagccagacaagtagaacaagatgaacaaaagccagcggcttttgagcgt
tgccgtttgtttagctcacccaaaaagcgttgtttatctgtcgctgagcaagtcgttaaa
caggtgaattgtgataacgaaaataaaatgcagcttgaggttattgacgatttagccgag
atggattttggttgttatgacggcgtggcttttgaatctatccctgctgattcagcaaaa
tggcaagagctcgaaaacttttggcaaaatccagccgagacagtattaccgcaagccgaa
accttgcaaagttttcatactcgaataattaacgcatggcataaggttttggctaaatta
caacaaagcgaatgttcgcacgctttattggtggtgcatggtggcgtcattcgtatgatc
ctaagtcatattcttgatttggattggcgaaatgccaaactgtattcgcaattagttatt
gattacgccagttttactgaattaagtgtgacagtgcatccagactgtaagccatttgtc
agggtgaaggctatcggtacgaaaccgacagcgcttaacaattccgtgcttaatcattca
gtgcttggtcattcagagcttagtcattcattgattaataaaaaacaaggagcaaaaggt
gccagctaa

DBGET integrated database retrieval system