KEGG   Catenovulum sp. CCB-QB4: C2869_04225Help
Entry
C2869_04225       CDS       T05408                                 

Definition
(GenBank) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cate  Catenovulum sp. CCB-QB4
Pathway
cate00260  Glycine, serine and threonine metabolism
cate01100  Metabolic pathways
cate01110  Biosynthesis of secondary metabolites
cate01120  Microbial metabolism in diverse environments
cate01130  Biosynthesis of antibiotics
cate01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cate00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C2869_04225
Enzymes [BR:cate01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C2869_04225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AWB65692
UniProt: A0A2S0VND5
Position
complement(1154675..1155766)
Genome map
AA seq 363 aa AA seqDB search
MDKQVQNKKIDLRSDTMSEPSADMLPDLASLDYGVDVFGENEQVNLLQNYAADLFGKPAA
LLFPTGVMANLAALIVHTPKGQEAIVGKSSHIFAHEGGNASVLGGIPLKPVDDEGGIFDL
NELAEAISDGAFFSTKTGLICLENTHNDKAGIAHKPDALQPIYQLAQQNNIPVHLDGARL
LNACAKYDIAANSFANCADSIMICLNKGVGAPMGALLIGETDFIEQAKGIRKLLGGSLNQ
PSVMAHMALKGLQNYQAKLSVDNANAAKLVELLSPYAQFDVKPTEQGTNIVYIFLRNPAK
PATEYIPEFEKYGVHLLANQIAYRAVFHSGVSAEDVEQIAQAFVEIFAVEHQGQQFVSTK
EQG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacaagtgcaaaacaaaaagatagatttacgctcagacaccatgtctgagccg
agcgctgatatgctgccagacttagccagcctagattatggcgttgacgtgtttggcgaa
aatgaacaggttaatttattacaaaactacgcagcggacttatttggtaaaccggcggcg
ttattatttcctaccggtgtcatggctaatttagcggctttgatagtgcataccccaaaa
ggccaagaagctatagtcgggaaaagttcgcatatttttgcccatgaaggcggcaatgct
tcggtattaggcggtattccacttaaacccgttgacgatgaaggcggcatttttgattta
aacgaactggctgaagcaatcagtgatggtgcttttttttcgaccaaaaccggtttaatt
tgccttgaaaatactcataacgataaagccggtatcgcgcataaacctgacgcgttacag
cctatctaccaacttgcccaacaaaacaatatacctgtccatcttgatggtgcgcgtttg
ttaaatgcctgtgccaaatatgatatagcggcaaatagttttgctaattgtgccgacagt
atcatgatttgtttaaacaagggggtaggtgcgccgatgggggctttattaatcggcgaa
accgattttattgagcaagccaaaggtattcgaaaattactgggtggtagcttaaaccaa
ccttcagttatggcacacatggcgctaaaaggattacaaaattaccaagccaaactcagt
gttgacaacgccaatgcagcaaaattagttgagctgttatctccttatgcgcagtttgat
gttaaacccactgaacagggtacaaacattgtgtatatctttttgcgcaatccagcgaaa
cccgccactgagtacattcctgagtttgaaaaatatggcgtacatttgttggcgaaccag
attgcctatcgtgcggtatttcattctggtgttagtgcagaggatgttgagcaaatcgcc
caagcttttgttgagatatttgccgttgagcatcaaggccagcaatttgtatcaacaaaa
gaacagggatag

DBGET integrated database retrieval system