KEGG   Catenovulum sp. CCB-QB4: C2869_09130Help
Entry
C2869_09130       CDS       T05408                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
cate  Catenovulum sp. CCB-QB4
Pathway
cate00340  Histidine metabolism
cate01100  Metabolic pathways
cate01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cate00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    C2869_09130
Enzymes [BR:cate01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     C2869_09130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF3404
Motif
Other DBs
NCBI-ProteinID: AWB66583
UniProt: A0A2S0VQU3
Position
complement(2581354..2582871)
Genome map
AA seq 505 aa AA seqDB search
MLNESLLEVKELPLNKEDKQALIGEYLHQLQNTKQHFLGYQTNQHCQLSDEIKPFLTMNL
LNLGDGFEDGDYRINAKVFERAIIQFYARLWHLSGTTKNEHISERQYWGYLTNMGATEGN
LCALWNAREYLSQAFTKTPVVLFSERTHYSINKACRLLQLDNMADIGSALGACPIRVEDA
TGIKDSSKSWPRAVPVNADGSIHIPALRQLAEFFVAQGHPIILNLNLGTTFNGAFDDIPL
AIQQLQHVLKQENSSGQRNYWLHVDGALAANYIPFIELNAARSSTPNSTFSSSRKQASTV
AQSPIPGFDFRYAQVMSISVSPYKWLGSPWPYGLFMTRRSLYSAGAHRPHYIGSYDTTLS
GSRNGFSALLLWDKVTRLGTSGLIALSQQIEQLTQYAYQQLQTLEQLSDTCKQVLCLQPR
IPHANIIVFKAPSQGLMQRFSLCSDLQQINGQSMRMSHLVILEHVSHSTIDLFVTALKQE
LQAQLEQSPTSKLTTSQKTKPITLI
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacgaaagcttactagaggttaaggaactaccgctaaacaaagaagataaacaa
gctttaattggcgagtacttacatcaactacaaaatactaagcagcattttttaggctat
caaaccaaccagcattgtcagttatcagatgaaataaagccttttttaacaatgaacttg
ctcaaccttggcgatggctttgaagatggcgattaccgcatcaatgccaaagtttttgag
cgagccattattcagttttatgcccgcctttggcacttgagtggaacgacaaaaaacgaa
catatcagcgagcggcaatactggggctatttaaccaacatgggcgcgacggaaggtaac
ttatgcgccttgtggaatgcgcgtgaatatttaagtcaagctttcactaaaacacctgtt
gtcttgttttctgagcgaacccactactccatcaacaaggcatgtcgcttattacagtta
gacaatatggccgatattggctcggcattaggagcttgccctattcgtgtagaagatgct
acaggcattaaagatagtagcaagtcatggccacgagcggttcctgtcaatgccgatggc
agcatacatataccggcattacgccaattagcagagttctttgtggcacagggtcaccct
attattctgaatctcaatcttggcactacgtttaacggcgcgtttgatgatattccgttg
gcgatccaacaattgcagcacgtgcttaagcaagaaaacagcagtggtcaacgcaattac
tggttgcatgtcgatggcgcactcgcggctaactacatcccttttatcgaactcaatgcg
gcgcgcagctcaaccccaaattcaacatttagctcaagccgcaaacaagccagcactgtt
gcgcaatcacctattcccggctttgattttcgctatgcacaagttatgtctatctctgtc
agcccttataagtggctgggctcgccgtggccttatggtttatttatgacacggcgttct
ttgtatagtgccggtgcgcaccggccacattacataggcagttacgatacaaccctatcg
ggttcgcgcaatggtttttcggcgttattactgtgggacaaagtcactcgcttaggcaca
tctggcttaatcgctttaagccaacaaattgaacaactcacgcaatatgcctatcagcaa
ttacaaacacttgagcaattatcagacacctgcaaacaagtattatgcctacagccacgt
attccacatgccaatatcattgtttttaaagcccccagccaaggcctaatgcagcgattt
tcgctgtgttctgatctgcaacaaatcaatggccaatcgatgcgcatgagtcacctagtg
atattggagcacgttagccacagcaccattgatttattcgtcacggcattaaagcaagag
ttgcaagctcagcttgagcaaagcccaacaagcaagcttacgacatcgcaaaaaaccaag
ccaattacgctaatttaa

DBGET integrated database retrieval system