KEGG   Catenovulum sp. CCB-QB4: C2869_17285Help
Entry
C2869_17285       CDS       T05408                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
cate  Catenovulum sp. CCB-QB4
Pathway
cate00520  Amino sugar and nucleotide sugar metabolism
cate01100  Metabolic pathways
cate01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cate00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C2869_17285 (nagA)
Enzymes [BR:cate01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     C2869_17285 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AWB68067
UniProt: A0A2S0VV18
Position
4625709..4626881
Genome map
AA seq 390 aa AA seqDB search
MKQHYRPTRFFNGQGFIDNAVISVENGVICGIDVAENEVAENLTSKATNNAINPQDITRL
NGTLAPGYIDVQVNGGGGVLFNNQPTLASLQAMFNAHRQYGTTALLPTLITDDIDVMQQA
ADAVAQAIKQPLSGIVGIHFEGPHLSVPKKGVHPAQHIRHISDQEWQLFSRNDLGIKKVT
LAPEAVSPEEIQRLTELNVIVSLGHSNATYEQTQAALAAGATGFTHLFNAMSPLTSREPG
VVGAALAAQQTYCGIIIDHHHVHSTSANLAYRLKSADKLVLVTDAMALIGSKQSHFNLFG
EQVALQGDKLTIDTGQLAGSHLSMQQAVQNSVNDLHIELGDCLKMASLTPATWLGLDEQM
GKIAVGYRADWVLLNDDLSVQQTWVAGQAS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacactaccgccctactcgcttttttaacggtcaaggttttatcgacaatgca
gtgatcagcgtcgaaaacggcgttatctgtggcattgacgtagcagaaaatgaagttgct
gaaaatctaacaagtaaggcaacgaataacgccataaatccacaagacataacccgctta
aatggcaccttggcacccggttatatcgacgtgcaagtcaatggtggcggtggtgtactg
tttaacaatcagccaacgcttgccagcttacaggccatgttcaatgctcaccgccagtat
ggcacaaccgcgttgctacccaccttgatcacagatgatattgatgtgatgcaacaagca
gcagacgcggtagcgcaagccattaaacagcctttatctggcatagtgggtattcacttt
gaaggcccacatttatccgtaccgaaaaaaggcgtgcatcccgcgcaacatattcgccac
attagcgatcaagaatggcaactattttcgcgcaacgacttaggtattaaaaaagtcacg
ttggcgccagaagcggttagccctgaggagatccagcgcctgacagagcttaacgttatt
gtgagcttaggccatagcaatgccacctatgagcaaactcaagcggcattggcggcaggc
gcgaccggctttactcacttatttaacgccatgtcgccattaaccagtcgcgagccaggg
gtagtaggggctgcactggctgcgcaacagacctattgcggcattattattgaccatcat
cacgtacacagtaccagcgccaacttagcttatcgcctaaaaagtgcagacaagttagtt
ctcgtgaccgacgccatggcattaattggcagtaagcaaagtcatttcaatttatttggc
gaacaggttgcattgcaaggtgacaagctaactattgatactgggcaactggccggttct
catttatccatgcagcaagccgtgcaaaacagcgttaacgatttacacatcgaactaggc
gattgcttaaaaatggccagcctaaccccagccacatggttaggtttagacgagcaaatg
ggcaaaattgccgtaggctatcgagccgattgggtattacttaatgacgatttatccgta
caacaaacttgggttgctggccaagccagctaa

DBGET integrated database retrieval system