KEGG   Catenovulum sp. CCB-QB4: C2869_17855Help
Entry
C2869_17855       CDS       T05408                                 

Definition
(GenBank) gluconolaconase
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
cate  Catenovulum sp. CCB-QB4
Pathway
cate00053  Ascorbate and aldarate metabolism
cate01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cate00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    C2869_17855
Enzymes [BR:cate01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     C2869_17855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL
Motif
Other DBs
NCBI-ProteinID: AWB68164
UniProt: A0A2S0VVB1
Position
complement(4755856..4756752)
Genome map
AA seq 298 aa AA seqDB search
MSNLLDAKLIDTVPVANILGEGVLWDEINQSVWWLDIEGCQIFQYHLATKQLETYSTPER
VGCFGFIENSDKLIVAFESGIGYFSPESGEIDWLAKPEQAQGSRFNDGRLDRLGRFWPGT
MMEAEQDAEPLAKLYQVNANGEVIERLDGIRVCNGLCWSPDGLVMYHADSPTRTIWRYDS
NPETGELSNKQVFVQTPENIFPDGSTVDKHGNMWNAQWDGARVTCYSPNGQQLGKIDVPA
GRSSCVAFGGENLDLMFVTSAKIGLTEQQLQEQPHAGHLFIYQLDQSIGLVEPRFKPE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacttacttgatgcaaaattgatcgacactgtgcctgttgccaatatcttaggt
gaaggtgtgctatgggacgaaattaatcaatcggtttggtggctggatattgaaggctgc
caaatttttcagtatcaccttgctacaaaacaattggaaacctattcaactccggagcgt
gtggggtgttttggttttatcgaaaatagcgacaagttgatcgtcgcatttgaatctggc
attggttacttttcaccagaaagtggcgagatcgattggctagctaaaccagagcaagct
caaggtagccgttttaacgatgggcggttagataggttagggcgtttttggcccggcacc
atgatggaagccgaacaagatgccgagccacttgccaaactatatcaagttaatgctaat
ggtgaggtgatagagcgcttggatggtattcgcgtttgtaatggtttgtgttggtcacct
gatggcttagttatgtatcacgcagattcgccgacccgcacaatatggcgctacgactca
aatcctgaaacgggtgagctaagtaataaacaagtttttgtgcaaacaccggagaatatt
tttcctgacggttcaacggtcgataagcatggcaatatgtggaatgcgcaatgggatggt
gcccgtgttacttgttattcaccaaatggtcaacaacttggcaaaatagacgtaccagcg
ggtcgttctagttgtgtcgcttttggtggcgaaaacttggatttaatgtttgtgaccagt
gccaaaataggcctaacagaacagcaattgcaagagcaaccgcacgcggggcacttattt
atttatcaattagatcagagtattggtttagttgaaccaagatttaaacccgaataa

DBGET integrated database retrieval system