KEGG   Chloroflexus aurantiacus: Caur_0420Help
Entry
Caur_0420         CDS       T00639                                 

Definition
(RefSeq) magnesium chelatase ATPase subunit D
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00860  Porphyrin and chlorophyll metabolism
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Caur_0420
Enzymes [BR:cau01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Caur_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 VWA AAA_5 VWA_3 VWA_CoxE Sigma54_activat Mg_chelatase MCM AAA_25 AAA_32
Motif
Other DBs
NCBI-GeneID: 5824720
NCBI-ProteinID: YP_001634059
UniProt: A9WDR4
Position
544494..546398
Genome map
AA seq 634 aa AA seqDB search
MVQKAIALPAAPLPFTAIVGLDTARQALLLLAVDPSLAGVAIGAGAGTGKSALVRAFARM
LAGGREFDPTIPWQLVEMPVGVSEDRLLGGIDIEATLATGERVHRSGLLARANGGMLYVD
SVNLLDDSTINHILSALDSGVVRVEREGISVVEPARFVLLVTYDPAEGPPRRHLLDRLGL
IVAPIGKAPVTTRAEVVRRNLQPGTDYEDDEALVLAGILAARELLPSVTISDEQVQQLSL
TAMALGIEGHRADLFAVRAARAAAALAGREEVNNDDLELAVRLVMLPRATRLPEMTPEEA
GPPPPPEPAPPPPSPENSDDEQRDDEEEKPPQPPEDELTIEELILAAMETDVPPDILETP
FTVRRRGRSGSRGTISGQRGRHIRSVPGKPAQGRLDVIATLRAAAPWQRIRAAEYHPHRR
GRIHLRADDLHIKKYRSKAGTLFCFLVDASGSMALHRMRQAKGAVNALLQQAYVHRDQVA
LLAFRGERADLLLPPSQSVELAKRALDVLPTGGGTPLAAALLAAYQISEQARSRGIFRTT
IVLITDGRPNVPLKADPTMDKARRLEQARQEVQQLAGRLRAAGVGAVVIDTQRSFVSRGE
AQQLAAWLGGRYVYLPNGRGDQIANAVIAASEEG
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaaaaagccattgcattaccggcagcgcctctgccattcacggcaattgttggc
ctggatacggcccggcaggcgctgctgttgctggcggttgatccatcactggccggggtt
gcgattggggccggcgccggcaccggcaaaagcgcactggtacgggcttttgcccgtatg
ctggccggtggtcgtgaatttgatccgaccatcccctggcagttggtcgagatgccggtc
ggcgtgagcgaagatcgactgctgggggggatagatattgaagcaaccctggcgacgggt
gagcgtgtccatcgcagcggtctgctggcccgcgccaatggcggcatgctctatgtggat
agtgtgaatctgctcgatgacagcacgatcaaccatattttgagcgcactcgatagcggt
gttgtgcgggtcgaacgggagggaatttcggtcgttgaaccggcccgcttcgtgttgctg
gtaacttacgatccggcagaagggccacctcgtcgccacttactcgaccgcctgggattg
attgtggcgccaattgggaaagcgccggtaacgaccagagctgaagtggtgcgtcgtaac
ttgcaacccggcaccgattacgaagatgacgaagcgctggtattggccggcatcctggct
gcacgtgagctattgccttcagtcaccatcagtgatgagcaggtccagcagttgagcctg
acagcgatggcactcggtattgaaggtcatcgtgccgacctgtttgcagtacgtgcagcc
cgcgccgccgctgcactggccggacgggaagaggtgaataacgacgatctcgaactggca
gtacgattggtcatgctgccacgcgcaacccgcctccccgaaatgacgccggaagaggcc
gggccgccgccaccaccggaaccggcgccacctccgccatcaccagagaatagtgacgat
gagcagcgcgacgatgaagaggaaaaaccaccgcagccgcctgaagacgagctgaccatc
gaagagctgattctggcagcgatggagactgatgtgccgccagacattctcgaaacaccg
tttaccgtgcggcgacgcggacggagcggctcacgcggcacaatttcgggtcagcgcggg
cgacatatccgctcggtgccggggaaaccggctcagggacggctcgatgtcattgccacg
ctgcgggcagccgcgccatggcaacggattcgggcagcggaataccatccccaccgacgc
ggacgtatccatctgcgtgctgatgatttgcatatcaagaaatatcgctcgaaggcagga
acgctcttctgctttctggttgatgccagcggttcgatggcgctgcaccggatgcgccag
gccaagggagcggttaatgcgctcttgcaacaggcctacgttcaccgcgaccaggtagcg
ttactggcattccgtggcgaacgcgccgacctgctactccccccatcacaaagcgtcgag
ctggccaaacgcgccctcgatgtcttgccaaccggtggtggtacccccctggccgcagcc
ctcctcgctgcgtaccagattagcgaacaggcccgctcacgaggcatcttccgcacaact
atcgtcttgatcaccgatggacggccaaacgtcccgctcaaagccgatccgacgatggac
aaagcacggcgactcgaacaggcccggcaagaagtgcaacaactggccggtcggctgcgt
gccgccggtgttggcgcggttgtgatcgacacccagcgcagctttgtgtcgcgtggtgaa
gcacaacaactggcggcctggctgggtggacgttatgtctacctgcctaacggacgaggt
gatcagatcgccaacgcggtgattgcagccagtgaggagggttaa

DBGET integrated database retrieval system