KEGG   Chloroflexus aurantiacus: Caur_0645Help
Entry
Caur_0645         CDS       T00639                                 

Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00860  Porphyrin and chlorophyll metabolism
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Caur_0645
Enzymes [BR:cau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Caur_0645
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Caur_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 DAO FAD_oxidored GIDA HI0933_like Pyr_redox_2 Thi4 FAD_binding_3 Pyr_redox Pyr_redox_3 MCRA AlaDh_PNT_C Lycopene_cycl Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 5828231
NCBI-ProteinID: YP_001634274
UniProt: A9WFE7
Position
866452..867876
Genome map
AA seq 474 aa AA seqDB search
MMAGYDSVVIGGGIAGLAAAYTLHKRGYRVLVIESTNRVGGVIQTITTPEGYILDCGPNT
VGTGDARLWQELIDLGLRERITPAAPCSKRRFILINGTPVEIPTSPVGLITTRLLSWRGK
LRVLAEPFINRGSTDPDESVAAFFTRRIGAEATAHLLDPFVAGVYAGDPQRLSTAAVFPS
LWEAAQRSGSIVRGMLSKPKPKTQVSEPKMRSRTFTFRGGLAEWPRALAQALGAGNVWTE
RRVVKLQPRDSWWEVTIDGVNGPETLISRSLIIATPAFTAADLIESVDQRAAGALRGIPY
APVAVVHLGFRRDQISQELSGFGVLAPSSEQRQFLGILWTSSIFPHVAPHDHVLTTTLSG
GAIRPELAERSDETLIEAAIRDHHQLLGIRGQPIFTHVTRWRTAIAQYTFGHRERIATLV
QLEQRLPTIQFAGSYRDGVGVPKTWASGVQAGERIAAALAAHGTTAVSTETASG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgggatacgacagtgtagtgattggcggtggcattgccggtttagctgcggct
tacacgctccacaagcgtggttatcgggtcctggtcatcgagtcgaccaatcgcgttggc
ggtgtgatccagaccatcaccacaccagaaggctacattctcgattgtgggccgaacacg
gtgggtaccggcgatgcgcgattgtggcaggaactgatcgatctgggtctgcgcgagcgg
atcacaccggcagcgccatgtagcaaacggcggttcatcctgatcaatggtacaccggtt
gaaatcccaacctcaccagtcgggctgattaccacgcgattactctcgtggcgggggaaa
ttgcgggtactggccgaaccgttcatcaaccgtggatcgaccgatcccgatgaaagcgtt
gctgccttcttcacccgccggattggtgcagaggctaccgcccacctcctcgatccattt
gttgccggcgtctacgctggcgatccgcaacggctctcgactgcggcagtctttccatca
ctgtgggaagcggcccagcgcagtggcagcatcgtgcgcggcatgctgagcaaacccaaa
ccgaagactcaggtgagtgagccaaagatgcgcagccgcacctttaccttccgcggtggc
ctggccgaatggccacgcgctctggcgcaagccctgggtgccggcaatgtctggacagaa
cggcgcgtggtcaagctccaaccacgcgactcctggtgggaagtgacgattgatggtgtg
aacggcccggagacactcatcagtcgcagcctcattatcgccaccccagcctttacggcg
gctgatctcattgagtcggttgatcaaagagcggctggtgccctacgcggcattccgtat
gcgccggtagcagtggtacatctcggctttcgtcgtgaccagatcagccaggaattgagc
ggctttggtgtgctggccccctcaagcgaacagcgtcagttcctcggcattctctggaca
tcaagcatcttcccgcacgttgcaccacacgatcatgtcctcaccacaaccctcagtggt
ggtgctatccggcccgaactggccgaacggagtgacgaaacactgattgaagcggccatt
cgcgatcatcaccagctcctggggatcagagggcaaccgatcttcacccatgttactcgc
tggcgaaccgccattgcccagtatacctttgggcaccgcgagcggattgccaccctcgtg
caactcgaacagcgcctgccgaccatccagtttgccggcagctaccgcgacggcgttgga
gtgcccaaaacctgggccagcggtgtgcaggcaggcgagcggatcgctgcggcactggca
gcccatggaactaccgcagtttccacagagacggcgtcggggtga

DBGET integrated database retrieval system