KEGG   Chloroflexus aurantiacus: Caur_0745Help
Entry
Caur_0745         CDS       T00639                                 

Definition
(RefSeq) protein kinase
Organism
cau  Chloroflexus aurantiacus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr FHA Yop-YscD_cpl APH Kinase-like DZR zinc_ribbon_2 zf-ribbon_3 zinc_ribbon_15 KIND
Motif
Other DBs
NCBI-GeneID: 5824816
NCBI-ProteinID: YP_001634372
UniProt: A9WG62
Position
complement(1019100..1020482)
Genome map
AA seq 460 aa AA seqDB search
MLMPDRLPDNLTVRGTNDAYTVLNLIGRGGMGAVYRVRRVSDGSIWALKEMRPLGDISDE
ELAETQHLFLQEAELLRSLSFPNLPVVIDLFAYEGRPTMIMEFVPGKTLEAILREANAPM
LEQQVIAYGIQLCRVLHYLHTRQPPIIYRDLKPANVILTPDGVLKLIDFGVARRHKAGKT
KDTIAMGSAGYAPPEQYGRGQTDAASDVYALGATMLHLLTAIPPVPLQPPRRGEIIRINR
SVSPETEAIVIRAMSLERDKRFASCLDMEQALHKLLKTPYVDPTLRMQPLPPTKPAAPPP
VVPPPASTLPGAGESVGVVCDQCGRLNKPQARFCAGCGTALSGKDVVAEPPLRKPPARLI
LRSPYRTWEVVLDRSPIRIGRRDPRRAHFPEIDLAEHDRGIASRLHAIIERRGDHYILTD
QKSTNGTEINGKQILPNVPQRLQAGDRIKIGEVEMEFRWN
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgcctgatcgacttccagacaatctgaccgtgcggggaacgaatgatgcgtac
acggtgctcaacctcatcggtcgtggaggtatgggagcagtgtaccgtgtccggcgggtg
agtgacggcagtatctgggccttgaaagagatgcggccgcttggcgacattagtgatgaa
gagctggctgaaacccaacacctttttttgcaagaggctgaactactgcgctcactatcc
ttccccaacttaccggttgtgatcgacctctttgcctatgaaggtcggcccaccatgatt
atggagttcgttcccggtaagacgctggaagccattctccgtgaagcgaatgcccccatg
cttgaacagcaggttatcgcgtatgggattcagctttgtcgagttctgcactatttgcac
acacgacagccaccgattatctaccgcgatctgaaaccggcaaatgtgattctgacgccg
gacggtgtgttgaagttgatcgattttggggtggcacgccggcataaagccggcaagacg
aaagacacgattgcgatggggtcagccggttatgccccgcctgagcaatacggtcgtggg
cagaccgatgctgcttcagatgtgtatgcgcttggcgcgacgatgctgcatctgttgacg
gccattccaccggtgccgttgcaacctccccggcggggtgagatcatcaggatcaatcgc
tcggtctcgcctgaaacagaggcgattgtgattcgggcgatgagcctggagcgcgataaa
cgttttgccagttgtctcgacatggagcaggcactgcataagctcttgaagacgccatac
gttgatccgacgctccggatgcagccgctgccgcctacaaagccggcagcgccaccgccg
gttgtgcccccacccgcatcaacgttgcccggtgcaggtgagagcgtaggggtggtttgt
gatcaatgtggacgcctgaacaaaccgcaggcacggttctgtgccggttgtggtacagcc
ctgtctggcaaagacgtcgtagcggagccaccactgcgcaaaccaccggcacgtctgatc
ctgcgctctccctatcgaacctgggaagtggtgctagatcgttcgccgatccggatcgga
cgccgtgatccgcgacgggcccattttcccgaaatcgatctggcagaacacgaccgcggg
attgcttcccgcctgcatgcaattatcgaacgacgtggcgatcactatattctcactgat
cagaagagcactaatgggacggagattaacggtaagcaaattttgcccaacgtgccgcag
cgtctgcaagctggtgatcggatcaagatcggtgaggtagagatggagtttcggtggaac
tga

DBGET integrated database retrieval system