KEGG   Chloroflexus aurantiacus: Caur_0792
Entry
Caur_0792         CDS       T00639                                 

Name
(GenBank) cobalt transport protein
Organism
cau  Chloroflexus aurantiacus
SSDB
Motif
Pfam: CbiQ
Other DBs
NCBI-ProteinID: ABY34030
UniProt: A9WGA9
Position
complement(1082747..1083412)
AA seq 221 aa
MAFHLDPRAKTLMALLWTVVLSTAASIPVLVIGMMPVLLIVWCSGQQPAFLRWLRLIALM
ITGWMIIALLTLDWQTALTVGLRILALSSIFFVFLRTTTPEDLGGAWQQTGAPFPLIFLL
TASLQYVQVMEQRIQHIIAAQRARGIPLEPGWRALRYYPALLIPLLVQALVSAGHLAAAM
EARGFSRAGRSQFLTYHWRLRDWLAIGMTVMAAGFLFWLRL
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcgttccaccttgatccacgcgcaaaaacgctgatggctctgctgtggacggtggtt
ctgagcacagccgcgagcattcccgttctcgtgatcgggatgatgccggtgttgctgatc
gtatggtgtagtggtcaacagcctgccttcctccgctggttacgcctgattgccctgatg
atcactggctggatgatcattgccctgctgaccctcgactggcaaaccgccttgaccgtt
ggtctacggattctggctctatcgagcatctttttcgtatttctccgcaccaccacaccg
gaagacctgggtggcgcgtggcagcagacgggagcaccattcccgctcatctttctgctc
accgcctccctccagtacgtccaggtgatggagcagcgcatccaacacatcattgctgcg
cagcgggcgcggggtattccacttgagccgggatggcgggcactgcggtattatccggcg
ctgctgattccactgctcgtgcaagcgctggtctccgccggacatctggccgcagcgatg
gaagcgcgcggtttcagtcgagccggtcgcagtcaattcctcacatatcactggcgtctt
cgcgattggcttgctattgggatgacggttatggcagccgggttcctgttctggttgcgc
ctttga

DBGET integrated database retrieval system