KEGG   Chloroflexus aurantiacus: Caur_0793
Entry
Caur_0793         CDS       T00639                                 

Name
(GenBank) thiW protein
  KO
K01552  energy-coupling factor transport system ATP-binding protein [EC:7.-.-.-]
Organism
cau  Chloroflexus aurantiacus
Brite
KEGG Orthology (KO) [BR:cau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cau02000]
    Caur_0793
Transporters [BR:cau02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    Caur_0793
SSDB
Motif
Pfam: ABC_tran ThiW AAA_21 SMC_N AAA_16 AAA_29 AAA_22 RsgA_GTPase AAA_18 Zeta_toxin Mg_chelatase AAA_30 AAA_33 SbcC_Walker_B TniB AAA_25 AAA_23 AAA_28 TsaE DUF815 Roc cobW ECF_trnsprt RuvA_C DLIC LPG_synthase_C
Other DBs
NCBI-ProteinID: ABY34031
UniProt: A9WGB0
Position
complement(1083412..1085568)
AA seq 718 aa
MKTRLIAQAVVLIALGVALAPFTSFPIGIARVNPTQHFINVIAAVLLGPWWATGIAGVIA
ILRISLGVGTILAFPGGMIGALLAGLIFRATRNMYLAALGEVIGTGIIAALVSGLWVAPV
FMQTSMALHLLIASFLSSTALGSAIALVVLKALERAGVVRLPGKEGLHTLRQIVVRDLSY
RYPQATQWTLRRLNLSIDAGEYVLLCGASGSGKSTLCRILTGLIPHVYEGSIEGTVLVDG
VDTREQSPADVCTRIGLVFQHPQWQLFNSTVTREIAFGLESLGYAPAEIRQRIDEVAGWL
GIEHLLARHPQQLSTGEQLLVALASILAMGSRIVVLDEPFANLDGRHVTQVQAILRRLHQ
QGVTIIVAEHRLGLVAADATRMIVLHNGQVVLDGPPVQVLAADIQQFHLEPPLPVQIGRA
LNLKPLPLTVEAVLAQVDHQQLATMYPLPPALPRSANGSPLLSVRDLSFSAGQRRVLNSV
HLDLYAGEGVAIVGANGAGKTSLIKHFNGLHRPQQGQVRVIGKDTRTTPVSVLARHVGMV
FQNPDDQLFTTRVRDEVAVGARVMGVYDPDQVAAVLRTFQLEHLVERSPFTLSAGEKRRL
TLAAALVTNPAILVLDEPTTGLDWPARQALARHLREQVQHGRTVVVVTHDLEFAGALTSH
WFVLADGCLLAEGVPHAICMQPAVVQAADLLLPDRYRLALALQHVAADAGGRQNEGEV
NT seq 2157 nt   +upstreamnt  +downstreamnt
gtgaagactcgactgattgctcaggcagtggtgctcattgccctcggtgtggcgctggct
ccatttacctcgtttcccatcggcatcgccagagtgaatccgacccagcacttcatcaat
gtgatagccgccgtactgctagggccgtggtgggcgaccggcattgccggtgtgatcgcc
atcctgcgtatctcgctgggggtggggacgattctggcctttccgggtggaatgattggt
gcgctgcttgccggtttgatctttcgggccacgcgcaacatgtatctggctgcgctgggt
gaggtgatcggtaccgggatcattgccgcgctggtgagtggtctgtgggtggcaccggtg
ttcatgcaaacctcaatggcccttcacctgttgattgcctcgttcctcagcagcacggca
cttggttcggcgattgccctggtggtgttgaaggctcttgagcgtgccggtgttgtgaga
ttacccggcaaagaggggttacataccttgaggcagatcgtcgttcgtgatctcagctat
cgctatccacaggcgacgcagtggacattgcgtcgcctgaacctgtcgattgacgccggt
gaatacgtgctgctctgcggtgccagcggcagcggcaaatcaaccctgtgccggatactt
accgggttgattccgcacgtgtacgaaggaagcattgaggggacagttctggttgacggg
gttgacacccgtgaacagtcacccgccgatgtatgcacccggatcggtctggtctttcaa
catccgcagtggcaactcttcaacagtacagttacccgtgagattgcctttggcctggaa
agtctggggtatgcaccggcagaaatccggcaacgtatcgacgaagtcgccggttggctc
ggcatcgagcatttgcttgcgcgacatccgcaacagctctccaccggtgagcagcttttg
gtagcgctggcgagtattctggccatggggtcgcggatcgttgtcctcgatgaaccgttt
gccaatctcgatggcaggcatgtgacgcaggtgcaggctatcctgcgcaggcttcatcag
caaggagtgacgatcatcgttgccgagcatcggcttgggctggtggccgccgatgcgacc
cgtatgatcgtgttgcacaatggtcaggttgtgctggatgggccgccggttcaggttctg
gccgccgatattcagcaatttcatctcgaaccaccattgccggtacagattggccgtgct
ctcaacctgaagccattgccgttgacggtagaggctgtgctggcgcaggtcgatcatcag
cagcttgcgaccatgtatccacttccacccgccttgccgcgctctgcaaacggatcgcca
ctgctcagcgtgcgcgatctctcgttctccgccggccaacggcgggtgctgaacagtgtt
catctcgatctgtacgcaggtgagggggtggcaattgtcggggctaatggcgccggcaaa
acctcgttgatcaaacacttcaacggtcttcaccgtccccaacagggacaggtacgggtt
atcgggaaagacacccgtacaacaccggtatcggtgctggcccgtcacgtggggatggta
tttcagaaccctgatgaccagttgtttacgacccgtgtccgcgatgaggtggcggttggt
gctcgcgtcatgggtgtctatgatccggatcaggtagcggctgtattacgcacatttcag
cttgaacaccttgttgagcgctcgccctttaccttgagtgccggcgaaaaacgacggctg
acactggcggcagcgctggtgaccaatccggcaatcctggtgctcgacgagccaacaacc
ggtctcgactggccggcacggcaggcgctggcccggcatctccgcgaacaggtgcagcat
ggtcgcaccgtagtcgtggtgacgcacgatctggagtttgccggcgcactcacctcacac
tggttcgtcctggccgatggatgcctgctggccgaaggggtacctcacgcgatatgtatg
caacccgccgtggtacaggcggctgacctcctgcttcctgatcgctaccggctggcgctg
gcgttacaacacgtggctgccgacgcgggcggtcgtcagaacgagggagaggtgtaa

DBGET integrated database retrieval system