KEGG   Chloroflexus aurantiacus: Caur_0856Help
Entry
Caur_0856         CDS       T00639                                 

Definition
(RefSeq) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00450  Selenocompound metabolism
cau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Caur_0856
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cau03016]
    Caur_0856
Enzymes [BR:cau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     Caur_0856
Transfer RNA biogenesis [BR:cau03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    Caur_0856
 Prokaryotic type
    Caur_0856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS S_layer_N
Motif
Other DBs
NCBI-GeneID: 5828247
NCBI-ProteinID: YP_001634478
UniProt: A9WGZ4
Position
complement(1171814..1172764)
Genome map
AA seq 316 aa AA seqDB search
MLATLRIPPQAQVLVGLTEGDDAAVYQLNSDTALVQTVDFFPPIVDDPYTYGAIAAANAL
SDVYAMGGKPLFALAIAAFPDDLDQSVMSAILQGGIDKAAEAGVAVVGGHTVSDREPKYG
LCVTGTIDPRQIITKAGAQPGDRLLISKPLGTGVITTAAKRDTITAADLATAIGSMLTLN
RQIAELMIQVDIHAATDVTGYGLLGHAGEIARQSKVALHITADAVPLLPGALAYTEAGMI
PGGLRRNLEFATSFTTFAPTVPPVYQLLLADPQTSGGLLIAAPPHAAAALQALCAEVGQP
LWEIGEVIDGSGIVVR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgacgttgcgcattccaccccaggctcaggtgttggtcggcctgactgaaggt
gatgacgcggcagtctaccaattgaatagcgataccgccctggtacagacggttgatttc
ttcccgcccatcgttgatgacccgtacacctatggcgctatcgccgctgccaatgccctg
agcgatgtctacgcaatgggagggaagccattgtttgcgttggccatcgctgccttcccc
gatgacctggatcagtcagtgatgtcggcgatcttgcagggtggcattgacaaagctgcc
gaagccggggtagcggttgtgggtgggcataccgtaagcgaccgtgagccgaaatatggc
ctctgtgtgaccggtacgattgatccacgacagattatcacgaaagccggtgcccaaccg
ggtgatcggttgttgatcagtaagccgctcggtaccggtgtgatcacgacggcagccaaa
cgtgacaccatcaccgctgctgatctggcaactgctatcggttcgatgttaacgctcaat
cgccagatcgccgaactgatgattcaggttgacatccacgctgcaactgatgtcaccggc
tacgggttactcggccacgccggcgagatcgcccgccagagcaaggtggcgctgcatatc
acagccgacgccgtaccgctcttgcccggcgcactcgcttacacagaagccgggatgatc
cccggcggcttgcgccgtaaccttgaatttgcgacgtcatttaccacctttgcccctact
gttccccctgtctatcaactgctgctggccgatccgcaaacctctggcggattgttgatc
gctgcaccgccacacgctgctgctgccttgcaggcactctgcgctgaagttgggcaaccg
ctgtgggagatcggtgaagtgatcgatggtagtggtatcgttgttcgataa

DBGET integrated database retrieval system