KEGG   Chloroflexus aurantiacus: Caur_1350Help
Entry
Caur_1350         CDS       T00639                                 

Definition
(RefSeq) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00360  Phenylalanine metabolism
cau00362  Benzoate degradation
cau00620  Pyruvate metabolism
cau00621  Dioxin degradation
cau00622  Xylene degradation
cau00650  Butanoate metabolism
cau01100  Metabolic pathways
cau01120  Microbial metabolism in diverse environments
cau01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Caur_1350
   00650 Butanoate metabolism
    Caur_1350
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Caur_1350
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Caur_1350
   00622 Xylene degradation
    Caur_1350
   00621 Dioxin degradation
    Caur_1350
Enzymes [BR:cau01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Caur_1350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3 Ldh_1_N
Motif
Other DBs
NCBI-GeneID: 5828455
NCBI-ProteinID: YP_001634967
UniProt: A9W9U2
Position
1866769..1867686
Genome map
AA seq 305 aa AA seqDB search
MQIDKVKVAILGSGNIGTDLMYKLLKQPGRMELALVAGIDPASEGLARARQIGIPTATDG
IESILADPDIRIVFDATSAKAHVRHARLLRDHGRIAIDLTPAARGPYVVPPVNLGEHLEA
HNVNLITCGGQATIPLVYAVSRVTAVRYAEMVSTVASRSAGPGTRQNIDEFTFTTARGLE
AIGGAREAKAIIILNPAHPPILMRNTIYVVPEGDFDEETVRQSVAQMVADVQQYVPGYRL
KSLPVIEQRSTPWGERPVIIMLLEVEGAGDFLPTYAGNLDIMTAAARRVGELFAAHLLSK
LEVTV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcgacaaagttaaagtcgccatcctcggttccggcaatataggcaccgatttg
atgtacaaactgctgaagcagccgggcagaatggagctggcgctcgttgcaggtatcgat
ccggcctctgaagggttggcgcgcgccagacagatcggtattccgaccgcaactgacggc
attgaatcgattctggccgatcctgatattcgtatcgtatttgatgccaccagcgcgaag
gcacacgtgcgccacgccaggcttttgcgcgatcatggacgcatcgctatcgatttgaca
ccggctgcacgggggccgtatgtggttccaccggtcaatctcggtgagcatcttgaggca
cataatgtgaacctcattacctgtggcggacaggcaaccattccgctggtttatgcggtg
agcagggtaacagccgttcgctatgccgagatggtgagcaccgttgcgagtcgttcagcc
gggccaggcacacgccagaatatcgatgagtttacctttaccacagcacggggcttggaa
gccatcggcggtgcccgtgaagcgaaggcgattattattttgaacccggcgcatccaccg
attctgatgcggaataccatctacgttgtgccagagggcgattttgatgaagaaaccgtc
cgccaatcggtggcacagatggtcgctgatgtacaacagtatgttcccggctatcggtta
aagagtttgcctgtcatcgaacaacgatcaacgccgtggggtgagcgaccggtcatcatt
atgctcctggaagttgaaggtgcaggtgattttctcccaacctatgccgggaatctcgac
atcatgactgccgccgcacgacgggtgggtgaactattcgccgcacacctcttgtcgaaa
ctggaggtgaccgtatga

DBGET integrated database retrieval system