KEGG   Chloroflexus aurantiacus: Caur_1365Help
Entry
Caur_1365         CDS       T00639                                 

Definition
(RefSeq) binding-protein-dependent transport system inner membrane protein
  KO
K02033  peptide/nickel transport system permease protein
Organism
cau  Chloroflexus aurantiacus
Pathway
cau02024  Quorum sensing
Module
cau_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:cau00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Caur_1365
Transporters [BR:cau02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Caur_1365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 5828470
NCBI-ProteinID: YP_001634982
UniProt: A9W9V7
Position
1882334..1883293
Genome map
AA seq 319 aa AA seqDB search
MIRYLLRRIVLLGGTVLISSLIIFLICRLLPGDVARVLLGREAGEAALAALRAELGLDRP
LPLQYIDWLRGLLTGDWGIAYSTRQPIRPLVMERLSNSLLLAGTTLALALPLGIGLGVWA
GWRAGKPDDTVISVSTLAVTGLPEFVTGLLLIDLFAFRLRWLPANSSIRPDTSFFEVLPQ
LVLPAITATLVLLAYIARLTRTGVIAEREQEYVRTAMLKGLSPATILRRHVLRNALLPAI
TVIAISLGWLISGLIVVENVYNYPGIGRLLTFAIDRRDLLLLQAVAMITVVIFAVANLLA
DLMYALLDPRIRLGDERSS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgatacgttatctgttacgacgaatagtgttgctcggcggcactgtgctgatcagctca
ttgatcatctttctgatctgtcgcctcttacccggtgatgtagcccgagtcctcctcggt
cgcgaagccggtgaagcggcgctggctgcactgcgtgccgaactggggttggatcggcca
ttgccactccaatacattgattggctgagaggacttctcaccggcgattggggcatcgca
tacagcacacgccaaccgattcgaccgctggtcatggaacgcctgagcaattcactcctg
ctggccggcacaacattagccctcgcactgccgttggggattgggttgggggtatgggcc
ggctggcgggccggcaaacccgacgacacagtcatcagcgtctcaaccctggcggtcacc
ggtctaccagagtttgtcaccggcctcctgctcatcgatctcttcgcctttcgcctgcgc
tggctaccggccaactcatcgatccggccagacacctcattcttcgaggtactcccccaa
ctggtattgccggcaatcacggccacgctggtactgctggcctacatcgcccggctaacg
cgcaccggggtgatcgccgaacgtgagcaggaatatgtccgcaccgcgatgctaaaagga
ctgtcaccggcaacgattctccgccgacacgtcttacgcaatgccttattgccggccatt
acggtgattgccatcagcctcggctggctgattagcggcctgatcgtggtcgaaaacgtc
tacaactatccgggtattgggcgtctgttgacctttgccatcgaccgccgcgatctcttg
ctgctccaggcggtagcgatgattaccgtcgtgatctttgctgtcgccaatctgctggcc
gatctcatgtatgccctcctcgacccccgcatccggctcggtgacgaacgcagctcttga

DBGET integrated database retrieval system