KEGG   Chloroflexus aurantiacus: Caur_1552Help
Entry
Caur_1552         CDS       T00639                                 

Gene name
apaG
Definition
(RefSeq) ApaG protein
  KO
K06195  ApaG protein
Organism
cau  Chloroflexus aurantiacus
Brite
KEGG Orthology (KO) [BR:cau00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Caur_1552 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-GeneID: 5828658
NCBI-ProteinID: YP_001635160
UniProt: A9WAZ0
Position
2135524..2135937
Genome map
AA seq 137 aa AA seqDB search
MRRPFYYRLSEGMRISVRPQYLPGHSFPPLQRFVFAYDVRIENISRRTAQLMSRRWLIYD
SIGEELEVVGDGVVGLQPVLGPGDVHEYQSYCVLKSPRGWMEGEYFFRTLDNTTFAAIIP
RFDLIADAEMIDDEERL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgaccattttattaccgtttgagtgaagggatgcggatcagtgtgcgtccccaa
tacctaccggggcactcattcccgccactacaacgcttcgtcttcgcctacgatgtacga
attgaaaatattagccgacgaacagcgcagttgatgagtcggcgctggctcatttacgac
tcgattggtgaggaactggaagttgttggtgatggagtggttgggttacagccggtgctc
ggccccggcgatgtccacgaataccagagctactgtgtgctcaagtcgccacgcggctgg
atggagggagagtacttttttcgcaccctcgataacacgacgttcgccgccatcattccg
cgtttcgacctgatcgccgatgcggagatgatcgatgatgaggagagattatga

DBGET integrated database retrieval system