KEGG   Chloroflexus aurantiacus: Caur_2281Help
Entry
Caur_2281         CDS       T00639                                 

Definition
(RefSeq) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00010  Glycolysis / Gluconeogenesis
cau00071  Fatty acid degradation
cau00350  Tyrosine metabolism
cau00625  Chloroalkane and chloroalkene degradation
cau00626  Naphthalene degradation
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
cau01120  Microbial metabolism in diverse environments
cau01130  Biosynthesis of antibiotics
cau01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caur_2281
  Lipid metabolism
   00071 Fatty acid degradation
    Caur_2281
  Amino acid metabolism
   00350 Tyrosine metabolism
    Caur_2281
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Caur_2281
   00626 Naphthalene degradation
    Caur_2281
Enzymes [BR:cau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Caur_2281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-GeneID: 5826745
NCBI-ProteinID: YP_001635879
UniProt: A9WGF8
Position
3103473..3104459
Genome map
AA seq 328 aa AA seqDB search
MRAMVFTAPGQPLEYRDLPVPTPQPEEVLIRVEACAVCRTDLHIIDGELPAPNLPLVPGH
QIVGTIERLGERVTRWTVGQRVGVPWLGWTCGECRFCRDGRENLCDQAQFTGYTRPGGFA
EYTVADQRFCFALPTDYDATAVAPLLCAGLIGYRALRLAGTGERLGIYGFGAAAHLMTQV
ARWQGREVFAFTRPGDTEGQRFARELGAVWAGSSTELPPVPLDAAIIFAPVGDLVPYALR
AVEKGGVVVCGGIHMSQIPAFAYELLWGERVLRSVANLTREDGEAFLQIAPQIPVRTTVQ
TFPLTELNTALNALRQGKLQGAAVIQIS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcaatggtcttcaccgcacctggtcaaccgctcgaataccgtgatcttccggtg
ccaacaccacagcccgaagaggtcttgattcgggttgaggcgtgtgctgtctgtcgtacc
gatcttcatattatcgatggggaattaccagcgccgaacctgccacttgttccaggtcat
caaattgtcggtactatcgagcgtctcggcgagcgggtcacacgctggacggttgggcaa
cgggttggggtgccctggctgggctggacgtgtggcgagtgccgtttttgccgtgatggg
cgcgaaaatctttgcgatcaggcgcagtttaccggctatacccgacccggcggctttgcc
gaatataccgttgccgatcaacgtttctgctttgctctacccaccgactacgacgcaacc
gcagttgcaccgttgctctgcgctggtctgatcggatatcgggcactccgcctggccggt
actggcgagcgactgggtatctacggcttcggtgccgcagcacacctgatgacgcaggtt
gcacgctggcagggtcgcgaagtcttcgccttcacccgtcccggtgatactgaagggcaa
cgttttgcccgcgaattaggcgcagtctgggccggcagttcaaccgagctgccgccggtg
ccactcgatgccgcaatcatctttgccccggtaggcgatctcgttccgtatgcgttacgt
gccgtcgagaaagggggcgttgtcgtctgtggcggcattcatatgagccagattcctgcc
ttcgcctacgaattgctgtggggcgagcgcgtattgcgctcggtcgccaacctaacccgt
gaggacggcgaggcattcctgcagatcgcgccacaaatcccggtgcggacaaccgtccag
acctttccactcaccgaactgaacacagccctgaacgcactccgccaggggaagttacag
ggtgccgccgtgatccagatttcgtaa

DBGET integrated database retrieval system