KEGG   Chloroflexus aurantiacus: Caur_2554Help
Entry
Caur_2554         CDS       T00639                                 

Gene name
chlL
Definition
(RefSeq) protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00860  Porphyrin and chlorophyll metabolism
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Caur_2554 (chlL)
Enzymes [BR:cau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Caur_2554 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ParA ArsA_ATPase AAA_26 AAA_24 MipZ SRP54 AAA_25 MeaB AAA_16 NB-ARC RNA_helicase
Motif
Other DBs
NCBI-GeneID: 5827023
NCBI-ProteinID: YP_001636149
UniProt: Q9F6X3
Position
complement(3406526..3407347)
Genome map
AA seq 273 aa AA seqDB search
MSLILAIYGKGGIGKSTTSANLSAAMALKGAKVLQIGCDPKHDSTFPLTGHLQPTVIDVL
DSVNFHLEDVSKEDVIRTGFAGVDTLESGGPPAGSGCGGYVVGETVKLLKEFGLYDKYDV
IVFDVLGDVVCGGFSAPLNYADYGLIIACNDFDSIFAANRLCLAISQKSQRHKVKLAGII
ANRVDYEYGGGTNLLDQFAEKVGTKVIGRVPYHDLIRRSRLAGKTLFEMEGPGKEECTRP
FEEMAEYLLAQPQATVPQPYHDRAIFEAIGGWR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcatcctcgcaatctatggcaagggtgggatcggcaagtcgaccacctcggcc
aacctctcggcggcaatggcgctcaaaggcgccaaagtgctccagatcggttgtgatccg
aagcacgacagcacctttccgttaaccggccatctccaaccgaccgtgatcgacgtgctg
gacagcgtaaatttccatctcgaagacgtgagtaaggaagatgtgattcgcaccggtttt
gccggcgttgacacacttgagtccggtggtccaccggccggtagcggatgcggcggctat
gtcgtgggtgagacggtcaaactgctgaaagaatttggtctctacgacaagtacgacgtc
atcgtcttcgacgtactcggcgacgtggtctgtggcggcttttcagcaccgctcaactac
gccgactacggcctgatcattgcctgcaacgacttcgacagcatcttcgccgccaaccgg
ctctgcctggcaatatcgcaaaaatcacagcgccacaaggtgaaactggccggcatcatt
gccaatcgcgtggactacgaatatggcggtggcaccaacctgctcgaccagtttgccgag
aaggtcggcaccaaagtcattgggcgcgttccgtaccacgatctcattcgccgctcgcgg
ctcgccggtaaaaccctcttcgagatggaggggccggggaaagaggaatgcacgcgcccc
ttcgaggagatggccgaatatctgttggcacaaccgcaggcaacagtccctcaaccatac
cacgaccgcgccattttcgaggccattggcggctggcgatag

DBGET integrated database retrieval system