KEGG   Chloroflexus aurantiacus: Caur_2587Help
Entry
Caur_2587         CDS       T00639                                 

Definition
(RefSeq) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00260  Glycine, serine and threonine metabolism
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
cau01120  Microbial metabolism in diverse environments
cau01130  Biosynthesis of antibiotics
cau01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caur_2587
Enzymes [BR:cau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Caur_2587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_3
Motif
Other DBs
NCBI-GeneID: 5827056
NCBI-ProteinID: YP_001636182
UniProt: A9WIR6
Position
complement(3449089..3450162)
Genome map
AA seq 357 aa AA seqDB search
MQGYALPLADPLPDRIDLRSDTVTLPSPAMRAAMSAAALGDDVYGEDPTVNELERLAAER
VGKEAAVLVVSGTMGNLAAMLAHCQRGQRVILGNESHIYHYEAGGASALGGLIYHPLSTD
PNGCIDLAELAEAATTIDDAHFAPPGVICLENTHNRRGGVVLTPDYLAQVRRIANDHSLP
VHLDGARIFNAAVALGVPVTDLTRHVDTVMFCLSKGLSAPVGSLVAGPADVIARVRRVRK
MLGGGMRQAGVIAAAGIVALTEMVDRLAEDHTNARLLAAGLAELPGIQIDLSKVQTNIVR
FTFVHPRLSVEAFLAALRKRGILMGSMSNTSIRAVTHYGIEAAHIEQVVSAAAEILA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggctatgctctgcctctcgctgatccgctgcctgatcggatcgatctgcgcagt
gatacagtaactttacccagtccggcaatgcgtgctgctatgagtgcagcggcactcggt
gatgatgtctatggtgaagaccccacagtcaacgagctggaacgactggccgccgaacga
gttggcaaagaagccgcggtactggtcgtcagcggcacaatggggaacctggctgccatg
ctcgcccattgtcagcgtggtcaacgggtgattctcggcaacgagagccacatttaccac
tacgaagctggtggggcgagtgcgttgggtggactgatctaccatccgctgtcaaccgat
cccaacggctgcatcgatctggcagaactggccgaggcagcaacgaccatcgacgatgcc
cactttgcgcctccgggggttatttgtctggaaaacacgcacaaccgccgcggtggggtt
gtgctaacccctgattatcttgctcaggtgcggcggatcgccaatgatcacagcttgccg
gtgcaccttgatggtgcacgcatcttcaatgccgccgttgccctgggtgtaccggtgacc
gacctcaccaggcacgtcgatacggtcatgttttgcctctcgaaagggctatctgccccg
gttggttcgctggtcgccggccctgccgatgtgattgcacgagtacgtcgggtgcgcaaa
atgctcggtggtggcatgcgtcaagcgggggtgattgccgcagccggtattgtggccttg
accgagatggttgatcgcctggctgaggatcacactaatgcccgcctgctggccgccggt
ctggctgaattgccgggtatccagatcgatctgagcaaagtacaaaccaacatcgtgcgc
ttcacctttgtccatcctcgtctgagcgtcgaggcattcctggccgccctacgtaagcgt
ggcattctgatgggtagtatgagcaacaccagcatccgggctgtgacccattacggcatc
gaggcagcgcatattgaacaggtggttagcgcagcggctgagattctggcctga

DBGET integrated database retrieval system