KEGG   Chloroflexus aurantiacus: Caur_2610
Entry
Caur_2610         CDS       T00639                                 

Definition
(GenBank) von Willebrand factor type A
Organism
cau  Chloroflexus aurantiacus
SSDB
Motif
Pfam: VWA VWA_2 VWA_3 VWA_CoxE GATase1_like YjeF_N FixH DUF412
Other DBs
NCBI-ProteinID: ABY35816
UniProt: A9WIT9
Position
complement(3482700..3485417)
AA seq 905 aa
MVLSVVEPAALWLFVLAIPLLGLIWLGRTDLHRRLGRVRLWLLVVVRCLILAALVLAVAG
LQIGRPVNATATVFLLDVSDSVSPAQRVATFDFIEQAVATADPDDRMAVIVFGARAMVER
VAEPPRPLNRIDALVAGSRTNIEDAIQLGLAILPDAMHRRLVLISDGGENAGQALTAARL
AAARGVPIEVVILSAERGPDALITALQAPTTADINQNIPLTVQIESEVEGAATVQLIADG
QLLAEQSVTVTPGRNQIAFSVPARESGFRRFEARLIAPFDTQPANNRAVAFTFVSGPPRV
LLLTVGPEQALALAEAWRAGGIEVTVQTPMQAPANPLDLRSFDAIALVDTPANAVSLALQ
RTLTTYVRDLGGGLLFIGGPQSFGAGGWRRSLLESLFPVSLDPPSREERFDLALTLVIDR
SGSMSELVDGLRTQLDLAREAAFQASLGLSRQDQLSIIAFDSVADVILPLQPLPDLATIE
DALSRLSAGGGTNIRSGMALAAETIATADARIRHVILLTDGVSETEYADLVANLRAQGVT
VSTVAIGLNTDPELERVAQIGGGKYYVVRQAEALPQILLEETVRVANRDLVEEPFTPALA
LPTPWLRNFSALPPLQGRNVVAERSISRVLLVADDGSPLLATAQIGVGRVLAWASDMTGH
WATAWLSWSAFPRFAAGLVSEVLPLNSDDYLSLSATVTADRVEIDLQARDRSGLPVELGE
IRSRISGLADEVVPDFVQIAPGRYRAITTIDQMGAYLVQVSATDRNGMPLGTVATGLTVN
YSPEYGQFAANPGLMTELAALTGGQVNPPPDLIFAPTERSVYEVWPVTMPLIWLALALLP
VDIALRRLFVAVPDWRPVVIRRPQRKPPEAKPSSSAPAPTSTLPQSDEERIAALLAAKRR
RRRDE
NT seq 2718 nt   +upstreamnt  +downstreamnt
atggtgctgagcgttgttgagccggcagcattatggctgtttgtgctcgccattcctctg
cttgggctgatctggctgggtcgtactgatctccaccgtcgccttgggcgtgtgcgatta
tggttgctggtggtggtacgttgtctgatcctggcagcgctcgtattggccgtggccggc
cttcagatcggtcgaccggtgaatgctaccgccacggtttttctgctcgatgttagcgac
tcagtctcacctgcccaacgggtagcaacattcgattttattgagcaggcggtggctacc
gccgatcccgacgaccgtatggccgtgatcgtgtttggcgcacgagcaatggtcgagcgc
gtggccgaaccgccccgtccactgaaccggatcgacgcgctggtagccggttcacgcacc
aatattgaagacgccatccaattgggactggcaattttgcccgatgcgatgcatcgacgg
ctggtgttgatctcggatggcggtgagaatgcaggtcaggcgttaacagccgctcgtttg
gcggctgcccgtggcgttccgattgaggtcgtcatcctgtcggcggagcgcggccctgat
gcgctgatcacggccttacaggcaccgacgacggctgacatcaatcagaacattccgcta
actgttcagattgaaagtgaagtcgagggcgcggcgacggtgcagttgatcgctgatggt
cagttgctggccgaacagtccgtgacggtgacacccggtcgcaatcagattgcattttct
gtaccggcacgcgagagtgggtttcgccgctttgaagcgcgtctgattgctcccttcgat
acccagccggccaacaatcgggcggtggcatttacctttgtcagtggcccaccgcgcgtg
ttgttgttaacggtgggaccggaacaggcactggcactggccgaagcatggcgtgccgga
gggattgaggtgacggtgcagacaccgatgcaggcgccggccaatccactcgatttgcgc
tccttcgatgcgattgctctagttgacacaccggcgaacgcggtttcgctggcacttcag
cgcaccctgacgacctacgtgcgcgatctgggcggtggactgctgttcattggtggcccc
caatcgttcggcgccggaggctggcgtcgttctctgctcgagtcgttatttccggtttcg
cttgatccgccatcgcgcgaggaacgcttcgatctggcgctgacgctggtcatcgaccgc
agcgggagtatgagcgaactcgtggacggtttgcgcacccaactcgatctggcccgtgaa
gcggcatttcaagcgagccttgggttatcgcgtcaggatcagctctcgattatcgccttc
gatagcgttgccgatgtgattttaccgttgcaaccactccctgatctggcgacaattgaa
gatgcgctgagtcgattatctgccggtggcggcacaaatattcgtagcggaatggcactg
gcagccgagaccattgccacggctgatgcccggattcgacatgtgatcctcttgaccgat
ggtgtctccgagactgaatatgccgatctggttgccaacctgcgcgcacaaggggttacg
gtcagtacggtggcgattggtctgaataccgatccagaactcgaacgagtggcgcagatc
ggtggcggtaaatactacgttgttcgtcaagccgaagctctgccacagattctgctggaa
gagactgtccgggtggcgaatcgcgatctggtagaagagcctttcacacctgcacttgca
ttaccgacaccatggctgcgcaatttcagcgctttgccaccactgcaagggcggaatgtc
gttgccgaacggtcaatcagtcgggtgctcctggtcgccgatgacggatcgccgctcctg
gcgacggcccagatcggtgttgggcgggtgctggcctgggcaagtgatatgaccggacat
tgggcgactgcatggttatcctggtcagcatttccccgttttgccgccggattggtgtct
gaagtactcccactcaatagtgatgattatctatcgctcagcgcaacggtaaccgcagat
cgagttgaaattgaccttcaggcccgtgatcgcagtggattgcctgttgaattgggcgag
attcgcagtcgcattagtggcctggccgatgaagtcgtgccagattttgtgcagatcgcg
cctggacggtatcgtgcgatcaccaccatcgatcagatgggagcgtatctggtacaggtg
agtgcaactgaccgcaacgggatgccgctcggcacggttgccaccggtctgacggtgaac
tactcaccggagtatggacagtttgcggcgaatcctggcctcatgaccgaacttgcagca
ttgaccggtggtcaggttaatccgccgccagacctgatctttgctccaacagaacgttcg
gtgtacgaggtctggccggtaaccatgcctctaatctggctggcactggcattattgcca
gtagacattgcgctacgtcgactctttgtcgcagtgcccgactggcgtcctgttgtcatc
cgccgaccgcagcgcaaaccaccggaggcgaaaccatcttcatcagcgccagccccaacc
tctaccttaccgcaaagcgacgaagagcggattgccgcactactggcagcgaaacgacgc
cgtcgccgggatgagtga

DBGET integrated database retrieval system