KEGG   Chloroflexus aurantiacus: Caur_2842Help
Entry
Caur_2842         CDS       T00639                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00350  Tyrosine metabolism
cau00360  Phenylalanine metabolism
cau00380  Tryptophan metabolism
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Caur_2842
   00360 Phenylalanine metabolism
    Caur_2842
   00380 Tryptophan metabolism
    Caur_2842
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    Caur_2842
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cau04147]
    Caur_2842
Enzymes [BR:cau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     Caur_2842
    4.1.1.105  L-tryptophan decarboxylase
     Caur_2842
Exosome [BR:cau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Caur_2842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 SepSecS Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 5827313
NCBI-ProteinID: YP_001636432
UniProt: A9WEM4
Position
complement(3801989..3803410)
Genome map
AA seq 473 aa AA seqDB search
MQPDEFRRLGYQIIDMIADYRATIAQRPVWSQLRPGELRSQLPANPPEHPEPATDILTDI
ERLIIPGLSNWQHPRFFGYFPANASLASLLGDMLSGGLGQLGLNWQASPPLTELEELTTD
WMRQLLGLSETWRGVIQDTASTSTLVALLCARERATDHCQVRGGLQALPAPLVVYTSTQS
HSSVEKAVLLAGFGRDNLRLIPVDDQFAMRVDALEAAIAADRAAGRVPCAVVASIGATAT
TACDPLEPIGALCQREGIWLHVDAAMAGSAMILPECRQLWQGIEQADSLVLNPHKWLGAA
FDCSLYYVRDPQHLIRVMSTNPSYLQTSADGTVTNYRDWGIPLGRRFRALKLYFLLRCEG
AEGLRARLRRDLANARWLAAQVDATPHWRRLAPVPLQTVCVRHEPPGLTGEALDQHTLRW
VGMINASGAAYLTPAVLDGRWMVRVSIGAEPTEHADVVALWELMQAMATRVAP
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctgatgagtttcgtcgcctcggctatcagattatcgatatgatcgccgattac
cgtgcgactattgctcagcgcccggtctggtcacagttacgccccggtgagctgcgtagt
cagcttccggccaatccacctgaacatcccgaaccggccaccgacattctgaccgatatt
gaacgcctgattatccctggcctttccaactggcaacatccacggttctttggctatttc
ccggccaatgccagtctggcgtcattgcttggcgatatgctcagcggcggtctcggtcag
ttaggactcaactggcaggccagcccgccattgaccgaactggaagagctgaccaccgat
tggatgcggcagttgctcggcttaagcgagacgtggcgtggcgttattcaggacaccgcc
agcaccagtacgctggttgcactactctgtgcccgtgagcgtgcgaccgaccactgccag
gtgcgcggcgggctacaggcgctgccggcaccgctggtagtgtatacctcaacccaaagc
cacagctcggtcgaaaaggcggtgcttctggccggtttcgggcgcgacaatcttcggctg
attccggttgacgatcagtttgccatgcgcgtggatgccctcgaagcggccatcgccgcc
gaccgcgccgccggacgggtgccatgtgccgttgtcgccagcattggcgcaactgcgaca
accgcatgcgatccgctcgaaccgattggtgctctgtgtcagcgcgagggtatctggttg
cacgttgatgccgcaatggccggatcggcgatgatcttgcccgaatgtcggcagctctgg
caggggatcgaacaggccgatagtctggtactcaatccgcacaaatggctgggggcggca
ttcgattgttcgctgtactatgtgcgcgacccgcagcatctgatcagagttatgtctact
aatcccagctatctgcaaaccagtgccgacggtacggtcaccaactaccgtgattggggg
attccgctcggtcggcgcttccgggcgctgaaactctactttctcctgcgctgtgaaggt
gccgagggcttacgtgcccgcctgcggcgcgatctggctaacgcacgctggctggccgca
caggtcgatgcaacacctcactggcgacgcctggcaccggtgccgctgcaaacagtttgt
gtccgccacgaaccacccggactgacgggagaggcgctcgatcagcacacgttacgctgg
gtcggtatgattaacgccagcggggcagcttacctcacgccggcagtactcgatggacgc
tggatggtgcgggtgagtatcggcgccgagccaaccgaacacgccgatgttgtggccttg
tgggagctgatgcaagccatggccacacgtgtcgcaccgtag

DBGET integrated database retrieval system