KEGG   Chloroflexus aurantiacus: Caur_2937Help
Entry
Caur_2937         CDS       T00639                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00010  Glycolysis / Gluconeogenesis
cau00260  Glycine, serine and threonine metabolism
cau00680  Methane metabolism
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
cau01120  Microbial metabolism in diverse environments
cau01130  Biosynthesis of antibiotics
cau01200  Carbon metabolism
cau01230  Biosynthesis of amino acids
Module
cau_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caur_2937
  Energy metabolism
   00680 Methane metabolism
    Caur_2937
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caur_2937
Enzymes [BR:cau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Caur_2937
Membrane trafficking [BR:cau04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Caur_2937
Exosome [BR:cau04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Caur_2937
  Exosomal proteins of melanoma cells
   Caur_2937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 5827409
NCBI-ProteinID: YP_001636525
UniProt: A9WFY2
Position
complement(3944147..3944662)
Genome map
AA seq 171 aa AA seqDB search
MLSDLFLIRHGQPVHNPSIPYQLPPGPDLSERGRVEARQVANFLADKGIEQLLVSPFART
TQTAEVLVDVLNIPVAFTTLVQEHAPGETFEQVRARIREVLAGLADSPYRRIAIVSHGSP
IRAFLLELSHDQIDLRHHVYPGGNPAPTCGIWHVTFTNQRASRFDLVFKPS
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
gtgctttccgatctctttcttattcgccacggtcaacctgttcacaatccgtctattccg
taccagttaccgccagggcctgatctgtcggaacgagggcgtgttgaggctcgccaggtc
gcgaactttctggccgataaagggattgagcagctcttggtctcaccatttgcccgtacc
acccagacggctgaggtgttggttgatgttctcaacataccggtcgccttcaccaccctg
gtgcaagagcatgcaccgggcgaaacgttcgagcaggtacgggcgcggatacgtgaggtt
ctggccggactggccgattcgccataccggcgaattgccattgtctcgcacggttcaccg
attcgggcattcctgctcgaattgagtcacgatcagatcgatctgcgtcatcacgtgtac
cctgggggcaatccggcccctacctgtggcatctggcacgtcacctttaccaaccagcgg
gccagccgattcgatctggtgttcaagccgtcctga

DBGET integrated database retrieval system