KEGG   Chloroflexus aurantiacus: Caur_3034Help
Entry
Caur_3034         CDS       T00639                                 

Definition
(RefSeq) major facilitator superfamily permease
  KO
K06902  MFS transporter, UMF1 family
Organism
cau  Chloroflexus aurantiacus
Brite
KEGG Orthology (KO) [BR:cau00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cau04131]
    Caur_3034
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cau02000]
    Caur_3034
Membrane trafficking [BR:cau04131]
 Autophagy
  Other autophagy associated proteins
   Others
    Caur_3034
Transporters [BR:cau02000]
 Major Facilitator Superfamily (MFS)
  Unknown transporters
   Unknown major facilitator-1 (UMF1) [TC:2.A.1.24]
    Caur_3034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATG22 MFS_1 MFS_2
Motif
Other DBs
NCBI-GeneID: 5827508
NCBI-ProteinID: YP_001636622
UniProt: A9WGR7
Position
4078480..4079820
Genome map
AA seq 446 aa AA seqDB search
MTTLAASTDNRREQVGWYFYDWANSAFSTTVVTVFLGPYLTSITRNAADANGFVYPFGIP
VAAGSFFPYMVSLSVLLQVFFLPILGAIADYSNARKQMLAIFAYVGAFATMGLYFLEGTN
YLLGGILFLIANLTFGASIVFYNAFLPDIASPDRRDAVSSQGWALGYLGGGLLLAANLVF
FLNAGSFGVESGMAVRISLVSAGMWWAIFTLIPMWTLRNRGAVRRLPPGENYLTVGFRQL
AHTFRQMRGYPQTLLFLAAYLLYNDGIQAVIALAAQFGAEELGIGESTRIATILMVQFVA
FFGALIFGALATRLGSKRVLLGSLVIWTLVVSYAYIMPANNDVQFFALGAAIALVLGGSQ
AISRSLFSLMIPDGQEAEYFSLYEVGERGTSWLAPLLFGVAYQMTGSYRIAIVSLIIFFI
SGFILLLFVNVRRAAAEAGNQAPAHV
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcttgctgcctcgaccgataatcgtcgcgaacaggttggctggtatttttac
gactgggccaattcggcattttcgaccacagtagtgaccgttttcttagggccatacctc
acctcaattacccgtaatgcggctgatgcgaatggatttgtctatccgtttgggataccg
gtggcagccggttctttttttccttacatggtttcgctctcggtcttgttacaggtcttc
tttttacccatccttggtgccattgccgattactccaacgctcgcaagcaaatgctggcg
atctttgcgtatgtaggggcatttgccactatgggcctctactttcttgaaggcaccaac
tatctgctgggtggaatcctgttcctgatcgccaacctcacctttggcgcctcgatagtc
ttttacaacgctttcttgccggatattgccagtcctgatcggcgagacgccgtttcttca
cagggatgggcgcttggatatctgggcggcggcttattactggcggccaacctggtcttc
tttttaaatgccggctcgttcggggttgagagtgggatggcggtgcgaatcagcctggtg
tccgccggcatgtggtgggccatttttacgctcattccaatgtggacgctacggaaccgt
ggtgcagttcggcgcttaccgcctggcgagaactatttgacggtcggcttccgtcagtta
gcccacacatttcggcagatgcgcggttatccacaaaccctgctcttcctggcggcgtat
ctactctacaacgacggtattcaggcggtcattgcgctggctgcgcaattcggggccgaa
gagcttggcatcggcgagtcaacccggattgccactatcttgatggtacagttcgtcgct
ttcttcggcgccctgatcttcggtgctctggcaacacggttgggttcaaaacgagtgttg
ctgggtagtctggtcatttggacactggtcgtcagttatgcctacattatgccggccaac
aacgatgtgcaattctttgcactcggtgcggcaattgccctggtgttgggggggagtcag
gcaatcagtaggtcgctgttttcgctcatgatccctgatggtcaggaggcagagtacttt
agcctgtacgaagtgggtgagcgcggcacgagctggctggcgccactcttgttcggggtt
gcctaccagatgaccggtagctaccggatcgccattgtctcactgattatctttttcatc
agtgggtttatcctgctcttgttcgtgaatgtacggcgggcggctgccgaagccggtaat
caggcaccggcgcatgtgtag

DBGET integrated database retrieval system