KEGG   Chloroflexus aurantiacus: Caur_3802Help
Entry
Caur_3802         CDS       T00639                                 

Definition
(RefSeq) class III aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00860  Porphyrin and chlorophyll metabolism
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
cau01120  Microbial metabolism in diverse environments
Module
cau_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Caur_3802
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cau01007]
    Caur_3802
Enzymes [BR:cau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Caur_3802
Amino acid related enzymes [BR:cau01007]
 Aminotransferase (transaminase)
  Class III
   Caur_3802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 5825611
NCBI-ProteinID: YP_001637369
UniProt: A9WCL8
Position
5071302..5072633
Genome map
AA seq 443 aa AA seqDB search
MTLEEQYRRRFAGSATLAEKARVRFPGGATHDGRYADPFPLFMERASGPYKWDVDDNRMI
DYWCGHGALLLGHGHPTIVNAIQQQAPIATHLGANHRLELEWADLIADLIPAAERIRFTA
SGSEATTLALRIARAATGKTTIIRFAGHFHGWHDALAPGADPDDPHRGVLPATLSSLLIL
PTDLDQVAATLATHTDIAAVILEPTGASYGSIPLPDTFLIGLRELTQQYGVLLIADEVVT
GFRVAPGGACARAGVRPDLVCLAKIVAGGLPGGALVGRADLLDLLAHDENGPRGRIRQQG
TFNANPLSAAAGIAMLRAVATGEPGAIAAARGTMLIQMLNELFASYRLRGWTAFGDGSIF
HLFVDPATDLIPGEIPRNLPLATLKRGGDPQILRRLRMALHLNGVDLMRGRSGFVSAVHS
EEDIRATVAAVAAAIELVMAEPA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgaagagcaatatcgtcggcgatttgccggttcagcgacgctcgccgagaag
gcacgtgtccgcttccccggtggtgcaacccacgacggtcgttacgccgatccctttcct
ctcttcatggaacgagccagcgggccgtataagtgggatgttgatgacaatcggatgatc
gattactggtgcggacacggagccttactgctcggtcacggccatccaaccattgtcaac
gctattcagcagcaagcccccatcgccacccatctcggcgccaatcatcgccttgaactg
gaatgggccgatctgatcgccgatctcattccggcggctgagcgcattcgcttcaccgcg
tcgggaagtgaagcaacaaccctcgctctgcgcattgcccgcgcagctaccggcaagacg
acgatcatccgcttcgcgggccattttcacggctggcacgacgcgcttgcacccggtgcc
gatcccgatgatccccaccgcggagtattgccggcaaccctctcaagtttgctgatcttg
ccgaccgatcttgatcaggtggctgcgacgctggctacgcataccgacattgccgcggtt
attctcgaacctacgggtgcttcctacggttcgatcccgctcccggatacgtttctgatc
ggcttacgtgagcttactcagcaatacggtgtgctccttattgccgacgaagtcgttacc
ggctttcgggttgcgcccggtggtgcctgcgcacgtgccggagtacgccctgatctggtc
tgtctggccaaaattgtcgccggtggattgcccggcggggcgctagtcggacgggctgac
ctcctcgacctgctggcccatgacgagaatggcccccgtggacgcatccgccaacaggga
acattcaacgccaatcctctctctgctgctgccggcattgctatgctacgtgccgtcgct
accggcgaacctggtgctatcgccgccgcacgtggcacaatgctcatccaaatgctcaac
gaactgtttgcttcgtatcgtttgcgtggctggacagccttcggtgatggatcgatcttt
cacctgtttgtcgatccggcaaccgacctgatccccggtgagattccgcgcaatctgcca
cttgccacgcttaaacgcgggggtgatccgcaaatcctgcgccggctgcggatggcgtta
cacctgaatggtgtcgatttgatgcgggggcgcagtggttttgtgtcggctgttcatagc
gaagaggacattcgggctacggtggctgcggttgccgctgctatcgaactggtgatggcc
gaacccgcttga

DBGET integrated database retrieval system