KEGG   Caulobacter sp. FWC26: CSW63_04630Help
Entry
CSW63_04630       CDS       T05901                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
cauf  Caulobacter sp. FWC26
Pathway
cauf00270  Cysteine and methionine metabolism
cauf00920  Sulfur metabolism
cauf01100  Metabolic pathways
cauf01110  Biosynthesis of secondary metabolites
cauf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cauf00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CSW63_04630
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CSW63_04630
Enzymes [BR:cauf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     CSW63_04630
    2.3.1.46  homoserine O-succinyltransferase
     CSW63_04630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 zf-RING_6
Motif
Other DBs
NCBI-ProteinID: AZS19994
UniProt: A0A3S9VBP3
Position
complement(630515..631663)
Genome map
AA seq 382 aa AA seqDB search
MAALNLVTPTSGGTWRFPANEPLRLDSGGVIEGLEIAYQTYGQLNADKSNAVLICHALTM
DQYVASPHPVTGKPGWWPRLVGPGKPLDPARHFIICSNVIGGCMGSTGPASINPATGKTY
GLSFPVITIADMVRAQAMLVSALGVETLFAVVGGSMGGMQVQQWAVDYPERMFSAVVLAS
ASRHSAQNIAFHEVGRQAIMADPDWRGGAYADHGVRPEKGLAVARMAAHITYLSEPALQR
KFGRELQRDGLSWGFDADFQVESYLRHQGSSFVDRFDANSYLYITRAMDYFDIAASHGGV
LAKAFTRARHVRFCVLSFSSDWLYPTAENRHLVRALTAAGARAAFAEIESDKGHDAFLLD
EPVMDAALEGFLASAERDRGLV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggctgctctcaatctggtcacgcccaccagcgggggaacctggcggtttcccgccaac
gaacctctacggctggactcggggggggtcatcgaaggcctcgagatcgcctatcagacc
tatgggcagctcaacgccgacaagtccaacgccgttctgatctgccacgccctcacgatg
gatcagtatgtggcctcgccccacccggtgacgggcaaacccggctggtggccgcgtctg
gtcggtccaggcaagccactggatcccgcgcggcacttcatcatctgctcgaacgtcatt
ggcggctgcatgggctcgacggggccggcgtcgatcaatccggcgaccggcaagacctac
ggcctgtcgttcccggtcattaccatcgccgacatggtgagggcccaggcgatgctggtc
tcggcgctcggggtcgagaccctgttcgccgtcgttggcggctcaatgggcggcatgcag
gtgcagcaatgggccgtggactatcccgagcggatgttcagcgccgttgtgctggcctcg
gcctcgcgccactcggcccagaatatcgcgttccacgaggtgggccgacaggcaatcatg
gctgacccggactggcgcggcggcgcctacgccgaccacggcgtgcggcctgagaagggt
ctcgccgtggcgcgcatggccgcacacatcacctatctgtccgaacccgccctgcaacga
aagttcggccgcgagctgcagcgcgacggcctgtcctggggcttcgacgccgacttccag
gtcgaaagctatctacgccaccaggggtccagcttcgtcgaccggttcgacgccaacagc
tatctctacatcacccgggcgatggactatttcgacatcgccgccagtcacggcggcgtg
ctggccaaggccttcacccgagcgcgccacgtgcgcttctgcgtgctgagcttctccagc
gactggctctaccccaccgcagagaaccgccatctggtccgcgcactgaccgccgccggc
gcccgcgccgccttcgccgagatcgagagcgataagggacatgacgccttcctgctggac
gaaccggtgatggacgccgcgctggagggcttcctggcctcggcggaacgcgatcggggg
ctggtttga

DBGET integrated database retrieval system