KEGG   Caulobacter sp. FWC26: CSW63_17880Help
Entry
CSW63_17880       CDS       T05901                                 

Gene name
ggt
Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
cauf  Caulobacter sp. FWC26
Pathway
cauf00430  Taurine and hypotaurine metabolism
cauf00460  Cyanoamino acid metabolism
cauf00480  Glutathione metabolism
cauf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cauf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CSW63_17880 (ggt)
   00460 Cyanoamino acid metabolism
    CSW63_17880 (ggt)
   00480 Glutathione metabolism
    CSW63_17880 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cauf01002]
    CSW63_17880 (ggt)
Enzymes [BR:cauf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     CSW63_17880 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     CSW63_17880 (ggt)
Peptidases and inhibitors [BR:cauf01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   CSW63_17880 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AZS22337
UniProt: A0A3Q9IJ15
Position
complement(3423315..3425051)
Genome map
AA seq 578 aa AA seqDB search
MKPFRLISTGLAAFALALSPIVSSEALAQKKQLLEYPSIHSPVVGERGMVVSQNAIATKV
GADILRQGGNAVDAAVATAFALAVTLPRAGNIGGDGFMMVHLAKTGETIFIDYRGVAPKA
AKLETFVDENGKEMDDVASRGYRAPTVPGTVAGLYLAHQKYGRLAWKQVVEPAYRLAADG
VALSPDEAFVFSWGKQRLSESEAGKQTFYKPGGELYRAGEVLKQPELAWSLRQIADKGAD
AFYRGEIAQRFAADMKAHGGLITLEDLAAYKAEIRQPLVGSYRGLTVKTSPPASAGGATL
LEMLNILESFDLKATGLGSAKTLHLQAEAMKMAYADRYKYLGDTDFVKVPLQGFTSKAYG
AQRAKLINPDKATPAKDLGAGDPWAFESPNTTHFSVADAEGNAVSNTYTLGADFGSGVMV
AGAGFVLNNQMNNYAHEAAWRAQKSGKPAPPNALQPGKRVLSTMMPTMIFKDGKPWLITG
TPGGSTIIDTVLQVIVNVVDFKLNVAEATHQPRIFQDASDTLRVEPNFNPDTVAILKAMG
HPITSDETMGSAQSIMIEQGLYLGGADPRRPGAEAIAP
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcctttccgccttatttccaccggcctagccgccttcgccctggcgctttcgccc
atcgtctcgtccgaggcgctggcccagaagaagcagctgctggagtatcccagcatccac
tcgccggtggtgggcgagcggggcatggtggtcagccagaacgccatcgccaccaaggtc
ggcgccgacatcctgcgtcagggcggcaacgccgtggacgccgccgtcgccaccgccttc
gccctggccgtgaccctgccgcgcgccggcaatatcggcggcgacggcttcatgatggtc
cacctggctaagacgggcgagacgatcttcatcgactatcgcggcgtcgcgcccaaggcc
gccaagctcgagaccttcgtcgacgagaatggcaaggaaatggacgacgtggcctcgcgc
ggctatcgcgcgcccaccgttccgggcacggtcgcgggcctctacctggcgcatcagaaa
tatggtcgcctggcctggaagcaggtggtcgagccggcctatcgcctggccgccgacggc
gtggccctgtcgcccgacgaagcctttgtcttcagctggggcaagcagcgcctgtccgag
agcgaggccggcaagcagaccttctacaagcccggcggcgagctctatcgcgccggcgag
gtcctcaagcagcccgagctggcctggtcgctgcgccagatcgccgacaagggcgccgac
gccttctatcgcggcgagatcgcccagcgcttcgccgccgacatgaaggcccatggtggc
ctgatcaccctggaggacctggccgcctacaaggccgagatccgtcagcccctggtcggg
agctatcgcggcctgacggtcaagacctcgccgcccgccagcgccggcggcgcgaccctg
ctggagatgctcaacatcctggagagcttcgacctgaaggccacgggcctgggctcggcc
aagaccctgcaccttcaggccgaggccatgaagatggcctatgccgaccgctacaagtat
ctgggcgacaccgatttcgtgaaggtcccgctgcagggcttcacgtccaaggcctatggc
gcccagcgcgccaagctgatcaatcccgacaaggccacgcccgccaaggacctgggcgcc
ggcgatccgtgggcgttcgaaagcccgaacacgacgcacttctcggtcgccgacgccgag
ggcaacgcggtgtccaacacctatacgctgggggccgatttcggctcgggcgtgatggtg
gccggcgcgggcttcgtgctgaacaaccagatgaacaactacgcccacgaggccgcctgg
cgcgcgcagaagagcggcaagccggccccgcccaacgccctgcagccgggcaagcgcgtg
ctctcgaccatgatgccgaccatgatcttcaaggacggcaagccgtggctgatcaccggc
acgccgggcggcagcaccatcatcgacacggtgctgcaggtcatcgtcaacgtcgtagac
ttcaagctgaacgtggccgaggccacccaccagccgcgcatcttccaggacgccagcgac
accctgcgcgtcgagccaaacttcaatcccgacaccgtcgccatcctgaaggcgatgggt
catccgataacctccgacgagaccatgggctcggcccagtcgatcatgatcgagcagggt
ctctatctcggcggcgccgatccgcgtcgcccgggggccgaggcgatcgcgccctga

DBGET integrated database retrieval system