KEGG   Caulobacter sp. FWC26: CSW63_18065Help
Entry
CSW63_18065       CDS       T05901                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
cauf  Caulobacter sp. FWC26
Pathway
cauf00040  Pentose and glucuronate interconversions
cauf00053  Ascorbate and aldarate metabolism
cauf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cauf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CSW63_18065
   00053 Ascorbate and aldarate metabolism
    CSW63_18065
Enzymes [BR:cauf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     CSW63_18065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh T4SS_CagC 3-dmu-9_3-mt
Motif
Other DBs
NCBI-ProteinID: AZS22370
UniProt: A0A3Q9IIT7
Position
3461285..3462871
Genome map
AA seq 528 aa AA seqDB search
MAHLTGELLIGGERRLGTHGEIKGVNPATGETLEPAFGGATKADVEAACALAAEAFGPYR
ALPYETRAQFLEAIAAQIEAIGDDLIVRTMAETGLPRPRLEGERGRTVGQLRLFASVLRD
GGFLEARIDPALPERKPLPRPDLRLRNVPLGPVAVFGASNFPLAFSVAGGDTASALAAGC
PVVVKAHPAHPGASELVGRAIQAAAAEVGVHPGVFAMIHDSGYEVSQALVADPRIKAAGF
TGSRRGGLALLAIAQGRPEPIPFYAEMSSINPVILLPGALKARAETIAPDFVAALTLGAG
QFCTNPGLILAIDGPELDAFVEAAGKAVEAAPASVMLTPGICQAFAHGVAALSDAAEVTT
VARGQTGPEHSHTGQAALFSVKAGDFLANPHLHEEVFGAASLVVRCAGQAELEAVIAALE
GQLTIAIHLEEADHGIAAALLPALELKAGRILVNGFGTGVEVAHAMVHGGPFPSTSDGRT
TSVGTLAIARFLRPVSYQNLPEALLPAELRTENPLGLTRRVDGLVKVG
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatctgacgggcgagcttctgatcggcggcgagcgccgcttggggacccacggc
gagatcaagggcgtcaatcccgccaccggcgagaccctggagccggctttcggcggggcg
accaaggccgatgtcgaggccgcctgcgccctggccgccgaggcgttcgggccctaccgc
gccctgccctacgaaacccgcgcccagttcctggaggccatcgccgcccagatcgaagcg
atcggcgatgacctgatcgtgcgcaccatggctgagaccggcctgccccgcccgcgcctg
gagggcgagcgtggccgcacggtcggccagctgcgcctcttcgccagcgtgctgcgcgac
ggcggcttcctggaggcgcggatcgatcccgccctgcccgagcgcaagccgctgccgcgt
ccggacctgcgcctgcgcaacgtgccgctgggcccggtggccgtgtttggcgccagcaac
ttcccgctggccttctcggtggccgggggcgacacggccagcgccttggcggccggctgc
ccggtggtggtcaaggcccacccggctcaccccggcgcctcggagctggtcggccgcgcc
atccaggcggccgccgccgaggtgggcgtgcatccgggcgtgttcgcgatgatccacgac
agcggctacgaggtcagccaggccctggtcgccgacccgcgcatcaaggccgccggcttc
accggttcgcgccgcgggggcctggccttgctggccatcgcccagggccggcccgagccg
atcccgttctacgccgaaatgagcagcatcaatccagtgatcctgctgccgggcgcgctg
aaggcccgggccgagacgatcgcgccggacttcgtggccgcgctgaccctgggggctggc
cagttctgcaccaatcccggcctgatcctggccatcgacggccccgaactggacgccttc
gtcgaagccgccggcaaggcggtcgaggccgcgccggcctcggtcatgctgacccccggt
atctgccaggccttcgcgcatggcgtcgcggccctgtcggacgccgcggaagtgaccact
gtggcgcgcgggcagaccggccccgagcacagccataccggccaggcggcgctgttcagc
gtcaaggccggcgacttcctggccaatccgcacctgcatgaggaagtgttcggcgccgcc
tcgctggtggtgcgctgcgcgggccaggccgagctcgaggcggtcatcgccgcgctcgaa
ggccagctgaccatcgccatccacctggaagaggccgaccacggcatcgccgccgccctc
ctgcccgccctggagctgaaggccggccgcattctcgtgaacggtttcggcaccggcgtt
gaggtggcccacgccatggtccacggcggcccgttcccctcgaccagcgacggccgcacg
acctcggtcggaaccttggccatcgcgcggttcctgcgtccggtcagctaccagaacttg
ccggaagcgctgctaccggcggagctgcggacggagaacccgctgggcctgacgcgccgg
gtcgatgggttggtgaaggtggggtga

DBGET integrated database retrieval system