KEGG   Candida auris: CJI97_000324Help
Entry
CJI97_000324      CDS       T04850                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
caur  Candida auris
Pathway
caur00600  Sphingolipid metabolism
caur01100  Metabolic pathways
Module
caur_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:caur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    CJI97_000324
Enzymes [BR:caur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     CJI97_000324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 40025471
NCBI-ProteinID: XP_028892717
Position
Unknown
AA seq 487 aa AA seqDB search
MSTEMLLSTFVRHGTITDTGISLQGPSSPNHTNTSSTLSSVCCWSTESEASAIYDIPYEN
IIWCEQANDDSVVKVFYVEDAGKKIKVRSMLVDLAYAVENDTIVDSVLKRAYRGSVVAPS
ILVVLNSFGGKGNAREIYREKILPVLEAAHVNITYQETTHHRHAVELGRELDESKYDVIA
CCSGDGVPHEIINGIYEKDDRGEAAFDKVAITQLPCGSGNALSLSTHGTNDASVAAFRML
KAQRTKMDVMAVTQKVDGADQTRLSFMSQAYGSIADADIGTEHLRWMGPIRFEIGVAHKL
VTRAKYPCDLWVHYGCEGEEVKRHFDKHTKLQNTNVSESPKKAGYPSLDDEPPSEWEKLS
SDICDNMNIFYVGKMPYMSDQAQFFPAALPQDGMMDMLVTNAKAPLLHMVGLFTKIDQGA
HVHSDEVIHAKVFGYRLVPKVKDDKTHYISVDGENFPLSPIQVEVIPRAVTVLLQNGSYV
ETCFTGS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacggaaatgcttctttcaacgttcgttcgtcacggcacaatcaccgacacgggc
attctgctccaagggccttcttcaccaaaccacactaatacctcgagcacgttgtcgtct
gtgtgctgctggagcaccgagtccgaagcaagcgcaatttacgatattccgtacgagaac
atcatctggtgcgagcaggccaacgacgacagcgtggtgaaggtgttctatgtggaagat
gccgggaaaaaaatcaaggtcagaagcatgctagtggatctagcgtacgcggtggaaaac
gacaccatcgtcgattctgtgttgaaaagagcctaccggggcagcgtggtggcgccgctg
atcttggttgtgctaaacagctttggcggaaagggcaatgctcgagaaatctaccgggaa
aaaatcttgcctgtgctcgaggccgcccacgtcaacatcacctaccaagaaaccacccac
cacagacacgcagttgagcttgggcgcgagctcgacgaaagcaaatacgacgtgatagcg
tgttgtctgggggacggagtgccgcacgagatcatcaacggaatctacgaaaaagacgac
cgtggcgaggcagcgttcgataaggtggccatcacgcagctcccgtgtggctcgggcaat
gctctctcgttgagcacccacggcaccaacgacgcctcggtggcagcgttccgcatgctc
aaggcccagcgcacaaagatggacgtgatggcggtgacgcagaaagtcgatggagccgac
caaactcgcctcagttttatgtctcaggcgtacgggctgatagccgatgctgacattgga
accgaacacttacggtggatgggacccatccgctttgagattggcgtggcccacaagttg
gttaccagggccaagtacccgtgtgacttgtgggtgcactatgggtgtgagggcgaagag
gtgaagagacactttgacaagcacaccaagttgcaaaacaccaatgtgagcgagagcccc
aaaaaggcagggtacccaagtctcgatgacgagcctccttccgagtgggagaagttgtcc
agtgatatctgcgacaacatgaacatcttctacgtgggcaagatgccctacatgtccgac
caggcccagttttttcctgctgcgttgcctcaagacgggatgatggacatgttggtgaca
aatgccaaagcgccgctacttcacatggtgggtttgttcacaaaaattgaccagggggcc
catgtccactcagacgaggtgattcatgcaaaggtgtttggataccgcttggtgccaaag
gtaaaagacgacaagacccactacatatctgtggatggagagaacttcccgttgctgccg
atccaggtggaagtgataccacgggcggtgactgtgttgcttcagaacggcctgtacgtg
gagacttgttttactgggagttag

DBGET integrated database retrieval system