KEGG   Candida auris: CJI97_000652Help
Entry
CJI97_000652      CDS       T04850                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
caur  Candida auris
Pathway
caur00020  Citrate cycle (TCA cycle)
caur00640  Propanoate metabolism
caur01100  Metabolic pathways
caur01110  Biosynthesis of secondary metabolites
caur01130  Biosynthesis of antibiotics
caur01200  Carbon metabolism
Module
caur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
caur_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:caur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CJI97_000652
   00640 Propanoate metabolism
    CJI97_000652
Enzymes [BR:caur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     CJI97_000652
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CJI97_000652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 40025799
NCBI-ProteinID: XP_028893034
Position
Unknown
AA seq 324 aa AA seqDB search
MLSKQFARGFASSVSAKNYASTIKNLKVNADTKVIYQGFTGKQATFHAEQAIAYGTKVVG
GTNPKKAGQEHLGKPVFASVKDAIKETGANATGIFVPPSIAAKAIEEAIEAEIELAVAIT
EGIPQHDMVRIAQILKTQSKTRLVGPNCPGLIAPDQCKIGIMPSHIHKRGKVGIISRSGT
LTYEAVAQTTQVGLGQSLVIGMGGDPFPGTNFIDALTLYLNDPETEGIILIGEIGGTAEE
EASEFLKQHNLSRPEGPKPVVSFIAGISAPPGRRMGHAGAIVAGGKGDAKSKIAALESAG
VVVEKSPARLGNSLLQEFKNKGLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgctttctaaacagtttgctcgtggtttcgcctccagcgtcagcgccaaaaattacgca
tctaccatcaaaaacttgaaggtgaatgccgacaccaaggtcatttaccagggtttcacc
ggtaagcaggctactttccacgccgagcaggccattgcttacggcaccaaggttgttggt
ggcaccaacccaaagaaggctggccaggaacatttgggcaagccagtgtttgcttcggtc
aaggatgccatcaaggagactggcgctaacgccacgggtattttcgtgccaccttcgatt
gccgccaaggccattgaggaggccattgaggctgagatcgagttggctgttgccatcact
gaaggtattcctcagcacgatatggtcagaattgcccagatcttgaagacccagtccaag
accagattggttggtcccaactgtcctggtttaattgctccagaccagtgcaagatcggt
atcatgccttctcacatccacaagagaggtaaggttggtattatctctagatccggtacc
ttgacctacgaggctgttgctcagaccacccaggtaggtttgggccagtccttggtcatt
ggtatgggtggtgaccccttcccaggtaccaacttcattgatgccttgactttgtacttg
aacgacccagagaccgagggtatcattttgattggtgagattggtggtactgctgaggag
gaagcttccgaattcttgaagcagcacaacttgtccagacctgagggtcctaagcctgtg
gtgtccttcattgccggtatctctgctcctccaggcagaagaatgggccacgctggtgcc
attgttgccggtggtaagggtgacgccaagtccaagatcgctgccttggagtctgctggt
gttgttgttgagaagtccccagctagattgggtaactccttgttgcaggaattcaagaac
aagggcttgttgtaa

DBGET integrated database retrieval system