KEGG   Candida auris: CJI97_002745Help
Entry
CJI97_002745      CDS       T04850                                 

Definition
(RefSeq) uncharacterized protein
  KO
K17434  large subunit ribosomal protein L53
Organism
caur  Candida auris
Brite
KEGG Orthology (KO) [BR:caur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:caur03011]
    CJI97_002745
Ribosome [BR:caur03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CJI97_002745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53
Motif
Other DBs
NCBI-GeneID: 40027891
NCBI-ProteinID: XP_028890002
Position
Unknown
AA seq 94 aa AA seqDB search
MITKYFTKVSVRFNPFSEAAKPVRLFIGRIPGVQKSGCTIDYKILNGNEEPLVKVTFKDK
NVMEINPENKRFEDLRAYFDAHSRKLALKDAISE
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgataaccaagtacttcaccaaagtctctgtgcggttcaaccccttctctgaggccgcc
aagcccgtcaggctatttattggaagaattcctggcgtccagaagagcgggtgcacaatc
gactacaagatcttgaatggtaacgaggagccactcgtgaaggttacctttaaggacaaa
aacgtaatggagatcaatccagaaaataagagatttgaagatttgagggcttacttcgac
gcccactcgagaaagttggctctcaaggatgccattctggagtaa

DBGET integrated database retrieval system