KEGG   Candida auris: CJI97_003097
Entry
CJI97_003097      CDS       T04850                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
caur  Candida auris
Pathway
caur00100  Steroid biosynthesis
caur01100  Metabolic pathways
caur01110  Biosynthesis of secondary metabolites
Module
caur_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:caur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CJI97_003097
Enzymes [BR:caur01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CJI97_003097
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 40028243
NCBI-ProteinID: XP_028890345
Position
Unknown
AA seq 441 aa
MSKLNPVTEHREFFGVPGALGIATFLPIVLVFFYSVCNEHYSLKGVSLDLNKVAEQIPYS
WNQWLDLVFDLTVWKAYLAWFFTLAVLDVYSPGKDMDGVTLRDGTKLQYRINGVFMSGTL
IVLLLGRLFASPDWFLPELQFLYDNQLKLIFITIIYSFIVSFVVYFMSFIPLRKENGLGT
KERILSINGNSGNPIYDWFIGRELNPRIGAWDIKLFCELRPGMLLLLLINLSCIHNQYHK
FGKISNSIVLINFLQAFYIFDGVLNEEGCLTMMDIATDGFGFMLAFGDLAWLPWSYSLQC
RYLSLEGNDVDLTWWQALSILALSFFGYYIFHSANQQKSDFKQGKLESMNSISTPTGSKL
LVDGWWKLSQHINYFGDWLIGWSWCLPTGTQSVLTYFYVIYFATLLVHRQTRDEAKCRAK
YGKAWEEYEKQVPYKIIPYIW
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgtcgaaattgaatcctgtcactgaacacagggaattttttggcgttccaggtgctttg
ggaattgcaacgtttttgcccattgtcttggtattcttctattcagtgtgcaatgagcac
tactctttaaagggcgtctcgcttgatctcaacaaggtggccgaacaaattccatactca
tggaaccaatggcttgaccttgtctttgatctcacggtttggaaggcttatttggcatgg
tttttcacccttgccgttctagacgtctattcccctggtaaggatatggatggtgtcact
ttacgcgatggaacgaaattacagtatagaatcaatggtgtcttcatgagcggtactttg
atcgtgttgcttcttgggaggctatttgcttcccctgattggttccttcctgagttgcaa
ttcttgtacgacaaccagcttaagttgatcttcatcaccatcatctattctttcattgta
tccttcgttgtgtactttatgtccttcatcccattgagaaaggagaatggcttgggaacg
aaggagagaattctttccattaatggtaactctggtaaccccatttacgattggttcatt
ggacgagaattgaacccaagaatcggtgcctgggatatcaaattgttttgtgaattgagg
cctggcatgctcttacttctcttgatcaacttgtcttgcatccacaaccaatatcacaag
tttggcaaaatttcaaattcaatcgtattgatcaatttcttgcaagcattctatatcttc
gatggtgttctcaacgaagagggttgcttgacgatgatggacattgccacggatggcttc
ggatttatgcttgcatttggcgacttggcgtggcttccatggtcttattctttgcaatgt
cgttatctttcgttagaaggcaacgatgtcgatttgacttggtggcaagccttgtcaatt
ttggcgctcagcttctttggctattacatattccactccgcaaaccagcagaagtcggat
ttcaagcaagggaagctcgaatcaatgaacagcatctcaactcctaccggctcaaagttg
ctcgtcgatggatggtggaagttatctcagcatatcaactacttcggtgattggcttatc
ggttggtcttggtgtttgccaacaggcacccagtcagtcttgacgtatttctatgtgatt
tacttcgctacattattggtacacagacagacgagagacgaggcaaaatgcagagcaaag
tatggcaaggcatgggaggaatacgaaaagcaagttccttacaaaattattccatacata
tggtaa

DBGET integrated database retrieval system