KEGG   Chlamydia avium: M832_08620Help
Entry
M832_08620        CDS       T03069                                 

Definition
(GenBank) Putative phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cav  Chlamydia avium
Brite
KEGG Orthology (KO) [BR:cav00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    M832_08620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AHK63711
UniProt: W8JGS1
Position
942367..943650
Genome map
AA seq 427 aa AA seqDB search
MMLALLFFVLLCGFYTSWNIGANDVANAVGPSVGSGVLTLRQAVIVAIIFEFLGALLLGN
RVTGTIESHIVSVSNPSIASSDYVYGMTGALLATGAWLQLASYFGWPVSTTHSIVGAVIG
FGLVLGKGAVIYWGSIGTIVISWFLSPLMGGGIAYLVFSFIRKNILYRGDPVQAVVRIAP
FLTAFVMIVLGVIIVCGGLITRFVSHTWALGVVFFLGGMSYILMFKYVHTSRCSHVCDTP
DVGSLLYRLKKCGGNYGRKYLVVERIFAYLQIIIACFMAFAHGSNDVANAIAPVAGVLRQ
LYPQMYSSYTLIGLMVFGGLGLIIGLSIWGWRVIETVGCKITELTPSRGFSVGLGAAITI
ALASAFGLPISTTHVVVGAVLGIGLARGIHAINLNIIKDIVMSWFITLPAGAILSILFFF
ALRALFH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atcatgcttgcgttactattttttgttcttttatgtggtttttatacctcttggaatata
ggagcaaatgatgtagcgaatgctgtgggacctagtgtggggtccggggtattaacctta
cgacaggcagtgattgtcgctattatttttgagtttctaggtgctttactacttggcaat
cgagtgacagggacaatcgagagtcatatagtatcagtttctaatccttcgattgcttcc
agtgattatgtttacggtatgaccggagctttacttgctacaggagcctggttacagcta
gcatcttattttggatggcccgtctcaacgacacattctatagttggagctgttattggc
tttggactcgtgttaggcaaaggagcagtaatttattggggatccataggaacaattgtt
attagctggtttctgtctcctttaatgggtggaggaattgcttatcttgttttttctttt
atacgaaagaatattttgtatcggggagatcctgttcaagctgttgtgcgtatagccccc
tttttgacagctttcgtaatgatcgtattgggagttattattgtttgtggtgggttaatt
acacgttttgtttctcatacatgggcattaggagttgtcttcttcttaggggggatgagt
tacatattaatgtttaaatatgtacatacttctcggtgttctcatgtttgcgatactcct
gatgtgggaagcttattgtaccgtttaaaaaagtgtgggggtaattacggaaggaaatac
ctagttgttgaaaggatttttgcttatctacaaattatcattgcctgttttatggcattt
gctcacggttctaatgacgttgcgaatgctatcgctcctgttgctggagtattgcgtcag
ctatacccacaaatgtattcttcctatacgttaattggactcatggtatttggtggctta
ggattaatcatcggcttatccatttgggggtggcgcgttatcgaaactgtaggatgtaaa
ataactgagcttacgccgtctcggggattttctgtaggtttaggagccgcaattactatt
gccctagcatcagcatttggattgcctatatctacaacacatgtagtggtcggagcagta
ttaggaataggtcttgctagaggaattcatgctattaatctaaacattatcaaagacata
gtgatgtcttggttcatcacccttcctgcaggagctatactctctattctatttttcttt
gctttaagagcgctcttccattaa

DBGET integrated database retrieval system